KEGG   Monopterus albus (swamp eel): 109959078
Entry
109959078         CDS       T05607                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:malb01002]
    109959078
Enzymes [BR:malb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109959078
Peptidases and inhibitors [BR:malb01002]
 Metallo peptidases
  Family M1
   109959078
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 109959078
NCBI-ProteinID: XP_020453839
Position
Unknown
AA seq 942 aa
MSVAPLLLLLLFASLSPSSGAQLPNQGQAQDVPIATNGQVFPWDRMRLPKTVSPLHYDLT
IHPNLTTLDFTGVVRILLDVHEDTDTIILHAKQMQISNALLLAPEGVRPLGVLEYPRFHQ
LGLLSDSVLIKGRKYEVQLEFAANLSDSFHGFYKSSYRTSSGEVRSLASTQFEATFARGA
FPCFDEPAFKANFTIQIIREPRHIAISNMPKVKTVELPGGLLEDHFDTTVKMSTYLVAYI
VSDFLSVSKTTQHGVKISVYAVPEKIDQTSFALDAAVKLLDFYDDYFDIPYPLPKQDLAA
IPDFQSGAMENWGLTTYRETGLLFDPDRSSASDKLGITKVIAHELAHQWFGNLVTMEWWN
DLWLNEGFAKFMEFISLDITYPDLHVDDFFLGKCFEAMEVDSLSSSHPVSTPVENPTQIQ
EMFDDVSYDKGACILNMLRDFLTPEAFEIGIIRYLKRYSYQNTVNSHLWESLTNICNSDG
LDEGRMEHKQFCSKHHLSSGSSKWYADDELDVKAIMDTWTLQEGFPLVTVEVRGREVRLS
QERYLKTDDPSLTEGFLWQIPLTYRTSASATTHRFLLKTKSDVLYLPEEVEWVKFNVDMS
GYYMVHYAGEGWKSIIKLLQNNHTALSSNDRASLIHNVFQLVSIGKVRLDTALELSLYLS
KETEIMAVTQGFGELVPLYKLMEKRDMAALENQMKGYIVNLFRRLIDRQEWADSGSVSER
VLRSYLLLFACVRNYTPCVTKATQLFNKWKDSNGNMSLPVDITMAVFVIGARTPEGWNFL
FEKYRHSLQMSVRSRMKTAMAVSPLQDKLKWMMEQSLHGAVMKTQDLPDVVVTVSKNPHG
YKLAWDFLRANWHTLIKKFDLGTNSLSYMVNGVTNQYSTREMLNEVQSFFGSLTEETGSE
MRCIQQTYETIEDNIRWMDTNLPLLQAWLDKHSHRVGMHVEL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgtcagtggctcctctcctgctgctgctgctgttcgcttccctttctccctcttcagga
gcacagctaccaaatcaaggccaagcccaagatgtccccattgccaccaacggccaggtg
ttcccctgggaccgcatgcgacttcccaaaactgtatcgccacttcactatgacctgacc
atccaccccaatctgaccacccttgacttcactggtgttgtgcgtatcctgctagatgtg
cacgaagacactgacaccatcattctccatgccaagcagatgcagatatccaatgcactg
ctcctggcacctgaaggcgtgagacctcttggggtgttggagtatcctcgtttccatcag
cttggcttgctgtcagactcagtgttgatcaaaggtaggaagtatgaagttcagctggag
tttgctgccaatctgtctgacagcttccatggtttctacaagagcagctaccgcaccagc
agcggggaggtccgctccttggcatccacgcagtttgaagcgacctttgctcgtggagcc
ttcccctgctttgatgaacctgccttcaaagccaacttcaccatacagattatacgagag
ccgcgccacatagccatatccaacatgcctaaggttaaaacagtggagttgccaggcggt
ttgcttgaggatcactttgataccactgtaaagatgagcacttacctggtggcctacatt
gtgtctgacttcctgtctgtgagcaagaccacgcagcacggcgtcaagatttccgtctac
gctgtacctgagaaaatcgaccagacatcctttgcactagatgctgctgtcaagttgttg
gacttctatgatgattactttgatattccttacccacttcccaaacaggacctggctgct
atccctgactttcagtcaggtgccatggagaactgggggctgaccacctacagagagacc
ggcctcctttttgacccggacagatcctcagcttcagacaaactgggtatcaccaaggtc
attgcccatgagctcgcacaccagtggtttgggaacctggtgacaatggagtggtggaat
gacctttggctcaatgagggtttcgccaagttcatggagtttatttctctcgacattacc
tacccagacctgcacgtggatgacttcttcttgggaaaatgctttgaggccatggaggtg
gactccctcagctcctcccacccagtttctacccccgtggaaaaccccacacagatccag
gagatgtttgatgatgtgtcatacgacaagggagcatgtattctgaatatgttgcgggac
ttcctgactccagaggcgtttgagataggcatcatccgatacctcaagcgctacagctac
caaaacactgtcaacagccacctgtgggagagcctgaccaatatctgcaactcagatggt
ctggacgaagggcgaatggaacacaaacagttctgctccaaacatcacctgtcctctgga
agttctaaatggtacgctgatgatgagctggatgtcaaagccatcatggacacttggacg
ctgcaggagggcttcccgctggtcactgtggaggtcagaggtcgggaggtcaggctcagt
caggagcggtatctgaagacagacgacccctccctcactgaaggattcctgtggcagatc
ccactgacctatagaaccagcgcctccgccaccactcaccgcttcctgcttaagacaaag
agtgacgtcttgtacctgccagaggaggtggagtgggtgaagttcaatgtggacatgagt
ggctactacatggtccactacgcaggcgagggatggaagtccattatcaaactactgcaa
aataaccacacagccctgagcagcaacgatcgcgccagcctcatccacaacgttttccag
ctggtcagtatagggaaggtgagactggacacagcactggagctgtctctgtacctgtcc
aaagagactgagatcatggctgtgactcagggctttggagagctcgtacctctctacaaa
ctaatggagaagagggacatggctgctctggagaaccagatgaagggttacattgtgaat
ctattccggcggctgattgatcggcaggagtgggctgactctgggtcagtgtctgagcga
gtgctgaggagctacctgttgctttttgcctgcgtcaggaactacactccctgtgtgacc
aaagccacccagctctttaacaagtggaaggactctaacggcaacatgagcctccctgtg
gacatcacaatggctgtgtttgtgattggagctcgaacaccagagggatggaacttcctg
tttgagaagtaccgccattcactgcaaatgtccgtcaggagccgcatgaagactgccatg
gctgtcagccctctgcaggacaagctcaagtggatgatggagcagagcctccatggtgcg
gtgatgaaaacccaggacctcccagatgtggtcgtcactgtcagcaagaacccccatggt
tacaaactggcctgggacttcctccgagccaactggcataccctgatcaagaagtttgac
ctcggcaccaactctttatcatacatggtgaatggggtgaccaaccagtattctaccagg
gagatgctaaatgaggtgcaaagcttttttggctccctgaccgaggagacgggttcagag
atgcggtgtatccagcagacctatgagacaatcgaggataacatccgctggatggacacc
aaccttcctcttctgcaggcttggctggacaaacatagtcacagagttggcatgcatgta
gagttgtag

DBGET integrated database retrieval system