KEGG   Monopterus albus (swamp eel): 109959668Help
Entry
109959668         CDS       T05607                                 

Gene name
mtmr3
Definition
(RefSeq) myotubularin-related protein 3 isoform X1
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00562  Inositol phosphate metabolism
malb01100  Metabolic pathways
malb04070  Phosphatidylinositol signaling system
malb04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109959668 (mtmr3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109959668 (mtmr3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109959668 (mtmr3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109959668 (mtmr3)
Enzymes [BR:malb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     109959668 (mtmr3)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     109959668 (mtmr3)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     109959668 (mtmr3)
Protein phosphatases and associated proteins [BR:malb01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    109959668 (mtmr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 109959668
NCBI-ProteinID: XP_020454864
Position
Unknown
AA seq 1241 aa AA seqDB search
MEEEGQHSLECIQANQIFPKKSPILEEENMQVPFPELHGEFTEYVGRAEDAITAVSNYRL
HIKFKESVVNVPLQLIESVECRDMFQLHVTCKDCKVVRCQFSTFEQCQEWLKRLNVAVRP
PSRLEDLFSFAFHAWCMDVYAGEKEQHGELCRPGEHVTSWFKNEVERMEFDTQNAWRISD
INSKFRLCPSYPQQLLVPAWITDKELENVAAFRSWKRFPAVVYRHLNTGAVIARCGQPEV
SWWGWRNADDEHLVQSIAKACAVDSSSCKHLLNGSYTNGTDLPDTDFESSMTNSSEVETL
ATQPHKLLILDARSYAAAVANRAKGGGSECPEYYPNCEVVFMGMANIHSIRKSFQSLRFL
CTQMPDPANWLSALESTKWLQHLSLLLKAALLVVNAVDRDHRPVLVHCSDGWDRTPQIVA
LSKLLLDPYYRTTEGFQVLVETEWLDFGHKFADRCGHGENSEDLNERCPVFLQWLDCVHQ
LQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLCNSGKERKDRHVQERTCSVWSLLRPANR
ALRNMLYSSHSEIVLHPVCHVRNLMLWTAVYLPSSSPTTPSDDSCAPYPGPGVNPEDAPL
GRRTKTRSFDNLPSACELGSSLAPNRRSSDPSLNEKWQDHRRSLELNVAAGPEGGGYQDQ
EVRPNGVLVYADGMDSELDDSPQPQDLQTELGRGASVNPASVGEEAEEAELSVAVGVAEG
QMENILQEATKEEAGADQKEGSTAVSHVFNNVDIELKQQAKVGEEDQCVKVNGTEMHREA
FVNGHHLENGVMESEEDGKSPAQAKQKAEELDQQAAEVTQTPENLVKQDVENASVQELLA
LGASEPQQPAAHRTLTNGFVDMSSEEPGVDQETRRDSESDRCVSELVELVDKRASLMESS
TETLTEEACSRLELPAQPPVCLSCQPCSDGRSELPFSRKERGLETGELGFIRTLNGGTKR
PSVSAFQSASADLSRDGLCNGESSYGEPCGGPHCVKGNGERAPLSRQVSLASCNSLVLPQ
RGSCSHYRWCLASLGRAANSPEQPSRSHLDDDGLTLHTDAIQQRLRQIEAGHQMEVETLK
KQVQELWCRLENQQHINSHRINGDMGDEVTSMTDSEYNLDPNCLSRCSTELFSETSWEQV
NTQDMEVTRWYPDHLAAQCYGCESMFWLATRKHHCSGREPVQEVWNCGNVFCASCCNQKI
PVPSQQLFEPTRVCKTCYSSLRLSLAPLDLELEKPITASSN
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaggggcagcacagcttggagtgcatccaggccaatcagatcttccccaag
aagtcccccatcctggaggaggagaacatgcaggtgccctttcctgaactgcacggggag
ttcacagaatatgtggggagagcagaggatgccatcactgctgtgtccaactaccgccta
cacatcaagttcaaagagtccgttgtcaatgtccctcttcagctcatagagagcgtagag
tgtcgggatatgttccagcttcatgtcacctgtaaggactgcaaagttgtcaggtgtcag
ttctccacctttgagcaatgtcaggaatggttgaaacgcctgaatgtggcagtgcgccct
ccctctcgcctggaggatctcttctcctttgccttccacgcctggtgcatggatgtgtac
gccggagagaaggagcagcacggcgagctgtgcaggccaggtgaacacgtgacctcctgg
ttcaagaacgaggtggagagaatggagtttgacactcaaaatgcttggagaatatcagac
atcaacagcaagttcaggctttgccccagttatcctcagcagctcctggtgcccgcctgg
atcactgacaaggagttggaaaatgtggcagcctttcgctcctggaagaggtttcctgct
gtggtttatagacacctgaacacaggggctgtgattgcccgctgtggccagccagaggtc
agctggtggggctggaggaacgctgatgatgagcacttggtccagtccattgccaaagcc
tgcgccgtggacagcagctcctgcaaacaccttctcaatggaagctacaccaacggcaca
gacctgcctgatactgactttgaatcatccatgacaaacagctcagaggtggagacgtta
gccacccagccccacaagttactgattctggatgccaggtcctacgccgcagccgtagct
aacagggccaagggtggaggcagcgagtgcccagagtactatcccaattgtgaggtggtg
tttatgggcatggccaacatccactctatccgtaagagcttccagtctctgcgtttcctc
tgtactcagatgcctgatccagctaactggctgtctgcactggagagcacaaaatggctg
cagcacctctctctgctattgaaggcagcactgctggtggtcaatgctgtggacagggac
cacaggcccgtcctggtgcattgctctgatggttgggaccgcacacctcagatcgttgct
ttgtccaagctgctgcttgacccctactaccgcactactgagggcttccaggttttggtg
gaaactgagtggctggactttggccataagtttgcagatcgctgcggccatggagaaaac
tctgaagatttgaatgagcgctgtcccgtcttcctgcagtggctggactgtgttcaccaa
ctgcagaggcagttcccatgctcctttgagtttaatgaggcttttctggtaaagctggtg
cagcacacctactcctgtctgtttggcaccttcctgtgtaacagtggcaaagagaggaag
gaccgccatgttcaggagaggacctgctcggtgtggtcgctgctcagaccagccaaccgc
gctctgaggaacatgctgtactcctcacactccgagattgttctccacccagtgtgtcat
gtgcgcaatctgatgctgtggacggctgtgtacctgcccagctcttcccccaccacccct
tccgatgattcctgtgccccctaccctgggcccggtgtcaacccagaggatgcgcccctg
ggcagacgtacgaagactcgctcctttgacaacttgcccagtgcatgtgagctgggaagc
tcactggctccaaaccgtcgctccagtgacccaagtctgaatgagaagtggcaggaccac
cggcgctccctggagctcaacgtggcagcggggcctgagggaggggggtaccaggatcag
gaggtgcggcctaatggagttttggtttacgcagatggcatggactctgagctggatgac
agcccacagccccaggacttacaaactgagcttgggcggggagcctctgtgaatccggca
tcagttggtgaggaagcagaggaggctgagctttctgtggcagtaggtgtggccgagggc
caaatggagaacattctccaggaagccacaaaggaggaggcaggagcagatcagaaagag
ggaagtactgctgtcagtcatgtctttaacaatgttgacatagagctgaagcaacaagca
aaagttggggaggaggatcagtgtgtgaaggtcaatgggactgagatgcacagagaagca
tttgttaatggtcaccatctggaaaatggtgtaatggaatctgaggaggatgggaagtcg
ccagctcaggccaaacaaaaggcagaggagctggatcaacaggcagctgaggtgactcag
acaccagagaatctggtgaagcaggatgttgaaaacgcttctgtacaagagctacttgca
cttggagccagtgagccacagcagcctgcagcccatagaactctaactaatggctttgtg
gacatgtcatctgaagagccaggtgtggatcaggagacccgccgtgactctgaatctgac
cgctgtgtctctgagctggtggagctagtggataagagggcctccctgatggaaagctcc
acagagactttaactgaagaggcctgcagcaggttggagctaccagcacagcctcctgtt
tgcctcagttgtcagccctgtagtgacggcaggagcgagctgcccttctccaggaaagag
agaggactggagacaggcgaactcggctttatcagaactttaaatgggggcaccaagcga
ccctctgtcagtgcctttcagtctgccagtgctgacctcagcagggacggactttgtaac
ggtgaaagctcctatggtgagccctgtgggggtccacactgtgtcaaagggaatggggag
cgggcccctctgagtcgacaggtgtctctagcgagctgtaactccctagtcctcccccag
cggggcagctgctcccattaccgctggtgccttgcctcactgggccgggccgccaacagc
ccggagcagccgtcccgcagccacctggacgatgatggactgacgctgcacacagacgcc
atccagcagaggctgaggcagatcgaggcagggcatcagatggaagtggagactctgaag
aagcaggtgcaggagctctggtgccgcctggagaatcagcagcacatcaactcacatagg
atcaacggagacatgggagatgaagtgacctcgatgacagattcagagtacaacctagac
cccaactgtttgtcacgctgcagcacagagctcttttctgagaccagctgggagcaggtg
aacacacaggacatggaggtcactcgctggtaccctgatcacttggcagcccagtgttac
ggctgtgagagcatgttctggctcgccaccaggaagcatcactgcagtggcagggaacct
gtccaggaggtctggaactgcggtaatgtgttctgcgccagctgttgcaaccagaagata
ccagtgccaagccagcagctgttcgagcccacacgcgtctgtaagacctgctacagcagc
ctccggctcagcttggctcccctggacctggagctggagaaacccatcacagccagctcc
aactga

DBGET integrated database retrieval system