KEGG   Monopterus albus (swamp eel): 109959716Help
Entry
109959716         CDS       T05607                                 

Gene name
galc
Definition
(RefSeq) galactocerebrosidase isoform X1
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00600  Sphingolipid metabolism
malb01100  Metabolic pathways
malb04142  Lysosome
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    109959716 (galc)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109959716 (galc)
Enzymes [BR:malb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     109959716 (galc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M
Motif
Other DBs
NCBI-GeneID: 109959716
NCBI-ProteinID: XP_020454965
Position
Unknown
AA seq 594 aa AA seqDB search
MAQTVLAVIAVYLNIFVGFCFSQIYILDDAGGLGRVFDGIGGLSGGGATSRLLVNYEEPY
RSHILDYLFKPNFGASLHMLKVEIGGDAQTTDGTEPSHMHYDNDENYFRGYEWWLMKEAK
KRNPNITLIGLPWAFPGWVGHGKNWPYDFPDITAAYVVKWILGAKQYHDLEIQYIGIWNE
RSYDSKYIKLLRYTLDKNGLDRVRIIASDYLWEPIAPSLLLDPELSRAVDVIGAHYPGTT
TVTEALKTNKKLWSSEDYSTFNDEVGGGCWARILNQNYVNGHMTATISWNLVASYYEELP
FGRDGLMTAKEPWSGSYVVESPIWITAHTTQFAQPGWTYLDTVGHLAKGGSFVALTDGRG
NLTVVIETMTHDHSVCIRPPLPPFNVTSQKAIFQLKGSFASIKELQVWRSQFNFKTKQPS
FFEKLTPLKLLDGSFTLNLAEDEVYTLTTITTGRKGSHPDPPPSACFPKVYKDDFHVRTP
PFSEAPNFADQTGVFEYYINLTDPGPHIFTLRQVVTQRPVTWTSDADQTISVIGDYQWQN
LTVTCDVYMESAKTGGVFIAARVDKGGQSVRTAKGVFFWVFADGTYKVTNDLGQ
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaacggtgttggcggtaattgcggtgtatctgaatatatttgtgggtttctgc
ttttctcagatttatatcctggacgatgcagggggattgggaagagtttttgacggaatt
ggaggtttgagcggcggaggggcgacttctcggttactggtcaattatgaagaaccgtac
cgcagccatatattagactacctgttcaagccgaacttcggagcttctttgcacatgctg
aaggtggagatcggaggagatgctcagactactgatggaacagagccatcgcacatgcac
tatgataatgacgagaactatttcagaggctatgagtggtggcttatgaaagaagccaag
aagaggaacccaaacattacactcattggtttgccctgggcatttcctggttgggtaggc
catggcaagaactggccctatgacttcccagacatcactgcagcatacgtggtgaagtgg
atccttggtgccaagcagtaccatgacctggagattcagtatattgggatttggaatgag
cgaagctatgacagcaagtacatcaagctgctgcggtacactctggataagaatggtctg
gacagggtcaggatcatagccagtgactacctgtgggagcccattgccccgtctctactg
ctagaccctgagctcagcagagctgtagatgtgataggggcccactatccaggcaccacc
acagtgacagaggctctgaagacaaataagaagctgtggtcgtcagaggactacagcacc
ttcaacgatgaggtgggtggaggctgctgggctcgcatcctcaaccagaactatgtcaat
ggacacatgactgcaaccatctcctggaacctggtggccagctactatgaagagctgccc
tttggcagggacgggctgatgacagctaaggagccctggagcggcagctacgtggtggag
tctcctatctggatcacagcccacaccacacagttcgcccagccaggatggacctacctg
gacactgttggacatctggcaaaaggtggaagttttgtagccctgactgatggcagagga
aacctcactgttgtcatagaaaccatgactcatgatcattcagtctgcataagacctcca
ttgcctccatttaatgtgacatctcagaaagcaattttccagctaaagggatcctttgcc
tccatcaaggagctccaagtatggcggtcacagtttaacttcaaaacgaaacagccttcc
ttctttgagaaactaactccactgaagcttttagatggctcattcaccttaaatctggct
gaagacgaggtttacacattaactacgattacaacaggacggaaaggcagtcacccagac
ccacctccttcagcttgtttccctaaagtttacaaggacgattttcatgttcgaacccct
cccttctctgaagccccaaactttgctgatcagacaggggtgtttgagtactacattaac
ctgactgaccctggacctcacattttcaccttacgacaagttgtgactcagagacccgtc
acatggacatcagacgctgaccagaccatcagtgtcataggagattatcagtggcagaac
ctcacagttacatgtgatgtgtacatggagagcgctaagaccggtggtgtgttcatagca
gccagggtggataagggaggacagtcagtccgcaccgctaaaggagtctttttctgggtg
tttgcagacggcacatataaggtcaccaatgatctcggtcagtag

DBGET integrated database retrieval system