KEGG   Monopterus albus (swamp eel): 109960327
Entry
109960327         CDS       T05607                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109960327 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109960327 (mecom)
Transcription factors [BR:malb03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    109960327 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-C2H2_8 zf-BED zf_C2H2_10 PyrI_C
Other DBs
NCBI-GeneID: 109960327
NCBI-ProteinID: XP_020455988
Position
Unknown
AA seq 1269 aa
MRSKGRARKLATSDGDDEFTLYPSDNIDDACGSDGDPSSALAEDPASPSLSNDKASPLDL
LSLQHPTIFLPQEGLPIPLDFELRESAVAGGGLGIWSCRKVNIGERFGPYEGEHRACLRD
TTQGWKILDGSGHVKFCVDASKPDIGSWLKHIQFAPAAKQHNLTACQIDDQIFYNVTREI
FPGEELLLFMKAEEYSCDAMAPDIHEERQYRCEDCDQHFESRNQLLDHQKQPCGMPPSSF
LNPGSDSDLKAQEPQDLRPLHMSHGLHECKECDQVFPDIQSLEAHILSHSEEREYKCDQC
PKAFNWKSNLIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGK
TFATSSGLKQHKHIHSSVKPFMCKSLRTYLCEVCHKSYTQFSNLCRHKRMHADCRTQIKC
KDCGQMFSTTSSLNKHRRFCEGKNHFTAGGLFAQGVPLPGAPGLEKSALAMGHSSAGLAD
YFGASRHHGGLTFPAAPAFPFSFPGLFPSGLYHRPPLIPATTSPVRQPTHAPVAGSGADL
SKSPLLPTSPGVQESRELLKALCKDGSSQVNQMPGSELHTKSSSSSTKQRNKQSDQSESS
DLDDVSTPSGSDLESTSGSELESDMDSERERGAARENGKGPKRKASEGGPMSSVLTSSND
AKDFPGPSLLQSSLDEHTAVTGAVNDSIKAIASIAEKYFGSTGLAGLQDKKVGSLPYPSM
FPLPFFPAFSPPVYPFPDRNLRPPSLKGEPQSPAEDCKKAQAKSSSESPFDLTTKRKEEK
SAPFAHSKPEATNSVGQDQPLDLSLGTRGRERNPREEETRKNMGYEEERGVVEIPKADTS
LQHARPTPFFMDPIYSRVEKRRMSDPFETLKDKYMRPTPGFLFHPQFRLPDQRTWMSAIE
NMAEKLETFGSLKQESSDLLRSVPSMFDFRAPPSALPETLLRKGKERYTCRYCGKIFPRS
ANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNL
DRHLKKHENGHLSGTAMSSPQSELDSGSAILDDKEDSYFNEIRNFISSTSQNQASPDPSE
EGLNGGPFEDKKPLMTSHGSHDLEDEEAEDLVADEKGDEPSNTCGKQEGQVLPSNLSDDI
IQDEIDFTGPNDLNLNCKTSPRRYKDDEDQRGYSALDHIRHFSDLRKLEESEQSDGDEDE
DDRSFDSASLTEPIKQPLFRKSKSQAYAMMLSLAEKDSLHPATHTPATIWHSLARAAAES
SAIQSLSHV
NT seq 3810 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcacggaaactggccacgagtgatggcgatgatgagtttacc
ctttatccatctgacaacatagatgatgcgtgtggctctgatggcgatccttcttcagcc
ctggcagaggacccagcatccccttcgctctcaaatgataaagcctcacccctggacctc
ttgtcattacagcacccgaccatctttttacctcaagaaggtttacctattcccttggac
tttgaactgcgagagtcagcagttgcaggtggaggcctgggcatctggagctgcagaaag
gtaaacattggtgagcgctttggaccatatgaaggagaacacagagcttgtctccgagac
accactcaaggctggaagattttggatgggtcaggccatgtaaaattttgcgtggatgcc
agcaagccagatatcgggagctggctgaagcacatccagtttgccccggcggccaagcaa
cataacctgacagcgtgccagatagatgatcagatcttctacaacgtcaccagagagatt
ttccccggtgaggagctgttacttttcatgaaggctgaagagtattcatgtgatgccatg
gctcctgatattcatgaggagaggcagtaccgctgtgaggactgtgaccagcactttgag
tcccgcaaccagctgctggaccaccagaagcagccgtgtgggatgcccccctcctccttc
cttaacccaggaagtgacagtgacctaaaggcacaagaacctcaagacctgcgacccctc
cacatgtcccatggactccatgagtgtaaggagtgtgaccaggttttccccgatatccag
agtctggaggcccacattctgtctcattcagaggagagggaatataagtgtgaccagtgt
cccaaggccttcaactggaaatcaaacttgatccgacatcagatgtcgcatgacagtggc
aagcactatgaatgtgaaaactgctcaaagcaggtgttcacagaccccagtaacctacag
aggcacatccgctcacagcatgttggggcgcgggcccatgcctgctctgactgtggcaag
acgtttgctacatcttcaggcctcaagcagcataagcacatccacagcagtgtcaagccc
ttcatgtgtaagtcactaagaacctacctatgtgaggtatgccacaagtcatacactcag
ttctctaacctgtgccgccacaaacgcatgcacgctgactgccgcacacagataaagtgt
aaggactgtgggcagatgttcagcaccacatcctccctcaacaaacaccgacgcttctgt
gaaggaaagaaccatttcacagcagggggattgtttgctcaaggtgtgccactccctggt
gcacctggcttggaaaaatcagctctggcaatgggccacagcagtgctggactggctgat
tactttggggcaagtcgccaccatggtgggcttactttccctgctgccccagcatttccc
ttcagcttccctggcctcttcccctctggactgtaccacaggccaccactcattcctgcc
accacttctcctgtcagacaaccaactcatgcacctgttgctgggtctggtgcagatctg
agtaagagtccactgttgcctactagtcctggtgttcaggagtcccgagagcttctcaaa
gctctctgtaaagatggcagctcacaagttaatcaaatgccaggatcagagctccatacc
aagagctcctcatcctccacaaagcagcgaaacaagcagagtgaccaatctgagagcagt
gacctggacgatgtcagcacccctagcggaagtgatcttgagagcacatctggctctgag
ctggagagcgacatggacagtgaaagggagaggggggctgctcgagaaaatggcaaaggc
cccaagaggaaggccagtgaaggaggccccatgagctccgtcctgacaagcagcaatgat
gctaaagactttccaggcccttcccttctccaatcctcgctggatgagcacacagctgta
acaggagctgtgaatgactctattaaggccattgcctcaattgctgagaagtactttggc
tccacagggctggctggcctgcaagacaagaaggtcgggtctctgccctatccatctatg
ttcccactgcctttcttcccagctttctctcctccagtttaccctttcccagataggaac
ctcagacctccaagcctaaagggtgagccacagtcaccagcagaagactgtaagaaggcc
caggccaaatcttcatctgaatcaccatttgacctcactaccaagcgaaaggaggaaaag
tcagccccctttgctcactccaaaccggaggccaccaattctgttggtcaggatcagcca
ctagacctgagtctggggaccaggggccgtgaacgcaatccaagagaggaggagacaagg
aagaacatgggttatgaagaggagaggggagtggtggagatcccaaaagcagacacctcc
ttacaacatgccagacccaccccatttttcatggacccgatctacagcagggttgagaag
aggagaatgagcgatccgtttgagactctgaaagacaaatacatgcggccaactccagga
ttcctctttcatccacagtttcgtttgccagaccagagaacttggatgtctgccattgag
aacatggcagagaagctggagacatttggctccttgaagcaagagtctagtgaccttcta
cgctccgtgccctctatgtttgacttcagagccccaccctctgcacttccagagacattg
ctgcgcaagggcaaggagcgctacacatgcagatactgtgggaaaatattcccacgttct
gccaacctgacccgtcacctcaggactcacacaggagaacaaccatataggtgtaaatac
tgtgaccgctccttcagcatctcttccaacctgcagcgtcacattcgcaacatccacaac
aaggagaagcccttcaagtgccacttgtgtgaccgttgcttcggtcagcagaccaacctg
gaccgtcacctcaagaagcacgagaacggccacctgtcaggtactgcaatgtcatctccg
cagtctgaactggacagtggcagtgccatattggatgacaaagaagattcttatttcaat
gaaataagaaatttcatcagcagcacaagccagaaccaggcatctcccgacccatcagag
gaagggttaaatggtggtccatttgaagacaagaagccactgatgaccagccatgggtca
catgaccttgaagatgaggaagcggaagaccttgttgctgatgaaaagggtgacgagcct
agcaacacctgtggaaaacaggaaggccaggtgcttcccagcaacctcagcgatgacatc
atacaagatgaaattgacttcactgggccaaatgacttgaacctcaactgcaaaacctct
cctaggaggtataaggatgacgaggaccagaggggctactcggccttggatcatattcgg
catttttcagacctgcgcaagctagaggagagtgagcagagtgacggagatgaagacgag
gatgatcgatcatttgactctgcctctctgactgagcccataaaacagccactctttagg
aaatctaagtctcaggcgtacgccatgatgctgtctctggctgaaaaggactctctccac
ccagccactcacaccccagccaccatttggcacagtctggcacgggctgctgctgaatcc
agcgccatccagtccctcagtcatgtatga

DBGET integrated database retrieval system