KEGG   Monopterus albus (swamp eel): 109962120Help
Entry
109962120         CDS       T05607                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00010  Glycolysis / Gluconeogenesis
malb00562  Inositol phosphate metabolism
malb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109962120
   00562 Inositol phosphate metabolism
    109962120
Enzymes [BR:malb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109962120
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109962120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Exostosin
Motif
Other DBs
NCBI-GeneID: 109962120
NCBI-ProteinID: XP_020459206
Position
Unknown
AA seq 504 aa AA seqDB search
MICCEETGLSKQLDYTQSCFLKTTHISCLEKYCGQLLFKPCLGCIMLTFFCKFAVFYFFI
ILPNYVNPGDHLDIPAIAKYFNTKGRYEEVKPYLIEDVLAVNRSILQPPSAQCQEIHLTA
IIRHGTRYPTTKNIKEMQKLYTIVMQNASGEESWLREIQTQWTMWYTEDMDGRLVQKGVN
DHRHLAVRLSKLFPSLISEEKLRGGLFKFITSSKHRCVNSTLSFKAGLTELWAIKDKQFD
HEVNDALMRFFEKCTRFVQEVDNNPSATTEVDLFKEGPEMRRVQEKIADRLRVPYNNVTD
DMAEAAFYMCAYEFAIKTVNSPWCRLFDEVDAQVMEYANDLKQYWKRGYGHDINSKSSCI
LFHDVFSRLDKAASENKSGQQVTEAVTVQVGHAETLLPLLTLLGFFNDSQALTSTNYATQ
SQRSFRTSHMLPYAANLLMVLYDCGGDELRLQPLLNEKPVTFPGLTDQQVSMPLYDDVKE
HYRELLQGCDFENECQLFKHPIEV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgatatgctgtgaggaaactgggctaagcaaacaactggactatactcagtcctgtttt
ttgaaaaccacacacatttcgtgtttggaaaagtattgtggacagctgcttttcaagcct
tgtcttggttgcatcatgctgacttttttttgtaaattcgccgtcttttatttcttcata
atcttacctaactatgtgaatcctggggatcatctggatataccagcaattgccaaatat
ttcaacacaaagggaaggtatgaggaagtgaaaccatatctcatagaggatgtacttgct
gtaaaccgatctatcctacagcccccatctgcacaatgtcaagaaattcatctgactgcc
ataataagacatggcacaagatatccgacaaccaaaaacataaaggagatgcagaagctt
tacaccatcgtcatgcaaaatgcctcaggtgaagagagctggctgcgtgaaatccagacc
caatggacgatgtggtacactgaggacatggacggccgactcgtccagaaaggtgtgaac
gaccacaggcatctggccgtcaggctgtcaaagctgttcccctctctgatttcagaggag
aagctccgaggtggactcttcaaattcataaccagctcaaagcacaggtgtgtcaacagc
acactgtcctttaaggcaggactgactgagctgtgggctattaaagataagcaatttgac
catgaagtgaatgatgccctaatgaggttttttgagaagtgcaccaggtttgtgcaggaa
gtcgataacaacccctcagctacaacagaggtggacctgttcaaggagggaccagagatg
aggagagtccaggagaagatagcagaccgtctccgggtcccgtataacaatgtcacagat
gatatggctgaagctgcattttacatgtgtgcttatgagtttgccatcaagaccgtgaac
tccccctggtgtcggctctttgatgaggttgatgcacaggttatggagtatgcaaatgat
ctgaagcaatactggaaaagaggttatggccatgatattaacagcaaatcaagctgcatt
cttttccatgatgtgttcagtcgcctggacaaggcagccagcgagaacaaatctggccag
caggtgactgaagctgtgacagttcaggtcggccatgcagagacgctgctgccactgctt
accctgctgggcttcttcaatgacagccaagccctgacatcaactaactacgccacacag
agccaacgttccttccgcaccagccacatgttgccctacgcagctaatttactcatggtg
ctgtacgactgtgggggagacgagctgagactgcagccgctgctcaacgagaagcctgtc
accttccccggtctgactgaccaacaggtctccatgcctctctatgatgatgtcaaagag
cactacagggaactgctccaaggctgtgattttgagaatgagtgtcagctcttcaagcat
cctattgaagtttaa

DBGET integrated database retrieval system