KEGG   Monopterus albus (swamp eel): 109962363Help
Entry
109962363         CDS       T05607                                 

Gene name
dusp10
Definition
(RefSeq) LOW QUALITY PROTEIN: dual specificity protein phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109962363 (dusp10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109962363 (dusp10)
Enzymes [BR:malb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     109962363 (dusp10)
    3.1.3.48  protein-tyrosine-phosphatase
     109962363 (dusp10)
Protein phosphatases and associated proteins [BR:malb01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    109962363 (dusp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Init_tRNA_PT Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 109962363
NCBI-ProteinID: XP_020459693
Position
Unknown
AA seq 468 aa AA seqDB search
MPPSPLDDRIVVALPRPIRPQELQLRLDTSYLDAFATSSGSKTVISTTVVKIRATANLVT
YMPSSKGSTRSLSCGCSSASCCSVTTYEKDSQSLNHSQVSASSPNLSYAGSPAPMVSNHE
ALSTPSLTPGTPKTISTVRVIHPNELAKRMTCCPMGHPIGPVPVIIDCRPFTEYNKSHIR
GAVHINCSDKISRRRLQQGKITVLDLISCREGKDSFKGIFSKEIVVYDESTMDPNRLTSS
QPLHVILESLRREGKDPIILKGGLSCFRQSHENLCEHSLQLHEGLDTGAAAGRTGALPHS
LPSTPDIENAELTPILPFLYLGNEHDXXXXXXXXXXXXXXXXXXXXXXXXXXXFIYKRLP
ATDSNKQNLRQYFEEAFEFIEEAHQAGMGLLIHCQAGVSRSATIVIAYLMKHTWMTMTDA
YKFVKTRRPIISPNLNFMGQLLEFEEDLNNGITPRILTPKLIGVETVV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatctcctcttgacgacagaattgtggtggcgctgccaaggccaatccgacct
caggaactccaactgcgcctggacaccagctatctggacgcctttgccaccagcagcggc
agcaagacagtcatcagcaccactgtggtgaagatccgggcgacggccaatcttgtaacg
tatatgccctcatccaagggctccacgcgctcgttgtcgtgtggatgcagcagtgccagc
tgctgctctgtgactacctatgagaaggacagccagagcctcaaccacagccaggtgagt
gccagcagtcccaacctcagctatgcggggtcccccgcccctatggtcagtaaccatgaa
gcattaagcaccccgagtcttaccccgggtactccgaagaccatatccaccgtgagggtc
atccatcccaatgagctggccaagcggatgacctgctgccccatggggcaccctataggg
cctgtgccagtcatcatcgactgccggccattcacggagtacaacaaaagccacatccgg
ggggctgtgcatatcaactgctccgacaagatcagccgacggcggctgcagcagggtaag
atcactgtgctggacctcatctcctgccgcgagggcaaggactcttttaagggcatcttc
tccaaagagattgtggtttacgatgagagcaccatggaccccaaccggctgacatcctcc
cagccactacatgtcatcctggagtcactgaggagggagggcaaagaccccattatcctc
aaaggaggccttagctgcttcaggcagagccacgagaacctatgtgagcactcactgcaa
cttcacgagggcttggacacaggcgcagctgctggccggacaggagcgctacctcactca
ctgccctccaccccggacatagagaacgcagagctgacaccaattctgccctttctttat
ctggggaatgagcacgacnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntcttcatctacaagcgcctgccc
gccactgacagcaacaagcagaacctacgccagtactttgaggaggcattcgaattcatc
gaggaagcacatcaagcaggtatgggccttctgatccactgccaggcaggcgtgtctcgt
tcagccaccatagtgatcgcctacctgatgaagcacacctggatgaccatgacagatgcc
tacaagtttgttaaaaccaggaggcccatcatctccccaaacctcaacttcatgggccag
ctgttggagttcgaggaggacctcaacaatggaataacaccacgaatcctcacaccaaag
ctaattggtgtggaaactgttgtctaa

DBGET integrated database retrieval system