KEGG   Monopterus albus (swamp eel): 109964091Help
Entry
109964091         CDS       T05607                                 

Gene name
erp44
Definition
(RefSeq) endoplasmic reticulum resident protein 44 isoform X1
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109964091 (erp44)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109964091 (erp44)
Membrane trafficking [BR:malb04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    109964091 (erp44)
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109964091 (erp44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin HyaE OST3_OST6 Thioredoxin_2
Motif
Other DBs
NCBI-GeneID: 109964091
NCBI-ProteinID: XP_020462797
Position
Unknown
AA seq 401 aa AA seqDB search
MKIENFSLSYMEVMGLSTPGQAEVTSLDSGNIDDVLNNAGVALVNFYADWCRFSQMLHPI
FEEASNIVREEFPDTKQVVFARVDCDQHSDIAQRYRITKYPTLKLFRNGMMMKREYRGQR
SVVAIADFIRQQQVDPVKEIHSLEEVNTLDRSKRNIIGYFETKDSDNYHTYEKVANILRD
DCTFLAAFGAVSQPERFSGDNVIYRPAGENAPDMVYFGSLANMDLSYAWTQDKCVPLVRE
ITFENGEELTEEGIPFLILFHIKEDTESLEMFQQEVARQLISEKGSINFLHADCDKFRHP
LLHIQKTPADCPVIAIDSFRHMYVFPDFKDVSVPGKLRQFVLDLHSGKLHREFHHGPDPT
DSTPGQEETGEVASSPPESSFQKLAPSETRYTILRRDRDEL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgaaaacttctcactgagttacatggaggtgatgggcctttcgactccagga
caagcagaagtcaccagtctggactcaggcaacattgatgatgtcctaaataatgctggg
gttgcattagtcaatttttatgcagactggtgtaggttcagtcagatgctccatccaatt
tttgaggaggcatctaacatagtgagggaggagtttcccgacaccaagcaggtggtgttt
gctcgtgttgattgtgaccaacattccgacatcgcccagcggtaccgcatcaccaagtat
ccaacactgaagttgttccgcaatggaatgatgatgaagagggagtacaggggtcagagg
tcggtggtagccattgctgacttcatccgccagcagcaggtcgaccctgtgaaagaaatt
cactcactggaggaggttaacaccctggatagaagcaagagaaacatcataggttacttt
gaaacaaaagactccgataactaccacacatatgaaaaagttgccaacatccttcgagat
gactgcacattcttggctgcctttggtgctgtgtctcagcctgagcgcttcagtggagac
aatgtgatctacagacctgctggtgagaacgctcctgacatggtctacttcggctcactc
gctaacatggacctgtcctacgcttggacccaggacaagtgtgtgcctctggtcagggaa
atcacttttgagaatggagaggagctgactgaagaagggatcccattcctcatcttgttc
catatcaaagaagacacagaaagcttagagatgttccaacaagaagtagctcgccagctc
atcagtgagaaaggttctataaacttccttcacgcagactgtgataagttccgccatccc
ctgctccatatccagaaaactccagctgactgtcccgtcatcgctatagactctttcaga
cacatgtatgtcttccccgactttaaagacgtcagtgtccctggcaagctgaggcagttt
gtattggaccttcactccggaaagcttcaccgagagtttcaccatgggcctgaccccaca
gacagcacacccggacaggaggagacgggagaagtggccagcagccccccagagagctct
ttccagaagctggcacccagtgagacccgctacaccatcctcagacgggaccgcgacgag
ctgtga

DBGET integrated database retrieval system