KEGG   Monopterus albus (swamp eel): 109964443Help
Entry
109964443         CDS       T05607                                 

Gene name
parp3
Definition
(RefSeq) LOW QUALITY PROTEIN: poly [ADP-ribose] polymerase 3
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb03410  Base excision repair
malb04210  Apoptosis
malb04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    109964443 (parp3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109964443 (parp3)
   04217 Necroptosis
    109964443 (parp3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:malb03032]
    109964443 (parp3)
   03036 Chromosome and associated proteins [BR:malb03036]
    109964443 (parp3)
   03400 DNA repair and recombination proteins [BR:malb03400]
    109964443 (parp3)
Enzymes [BR:malb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     109964443 (parp3)
DNA replication proteins [BR:malb03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     109964443 (parp3)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    109964443 (parp3)
DNA repair and recombination proteins [BR:malb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     109964443 (parp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR
Motif
Other DBs
NCBI-GeneID: 109964443
NCBI-ProteinID: XP_020463397
Position
Unknown
AA seq 528 aa AA seqDB search
MAPKRRAASAVRAGGKKVKEEPETTESKDPFTSAKEALLAAGPQVKGKKKVDEHCSLSTC
GQVYEDYDCMLNQTNVGHNNNKFYVIQVVEANNKYYLWNRWGRVGEVGQSKLNVFDKPES
AVKDFEKKFKDKTKNKWSDRMNFVSHSGKYTLIEVDGEEDAEVKVDSIDGKTVKVSKNVQ
PCTLDDATKNLIKLIFSNDMFKEAMECMNLDIKKMPLGKLSKLQIAKGFGVLEEIEAAIN
QKSKRSCLEELSSKFFTTIPHNFGRNRPPTIDNQEIVDQKKEMLMVLADIELAQTLKSET
EKAQEEMIDTVPHPLDQDYNSLKCKLTLMEKGTGTFKIIAKYLKETSCDFNEPKIVNIWE
VDRETEGQRFREHDKLENRRLLWHGTNIAVVAAXGLRIMPHSGGRVGSGIYFASENSKSA
SYVRTSKRTGVMFLSEVALGKECTITKDNSSLKKPPAGYDSVVARGTVEPDPSKDIIICL
DGKKVAVPQGKAIQQSQFSKSSFYNSEYLIYKESQCRLRYLLELNMSY
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaagagacgggctgcttctgctgtgcgggcagggggcaagaaggtgaaagag
gagccagaaacaaccgagtccaaggatcctttcacctctgcaaaggaggcccttctggct
gcagggccacaggtaaaaggcaagaagaaggtggatgagcattgctccctgtcaacctgc
ggacaggtgtatgaggactacgactgcatgctcaatcagacaaatgttggacacaacaat
aataagttctatgtgattcaagttgttgaagcaaacaacaaatattatttgtggaacaga
tggggtagagtgggagaagtgggacagtccaaacttaatgtgtttgataagcccgagagc
gccgtcaaggactttgagaagaagtttaaggacaagacaaagaacaaatggagtgatcgg
atgaattttgtgtctcactctgggaagtatacgcttatcgaggtggatggagaggaagat
gctgaggtcaaggtggacagtattgatggaaagacggtcaaagtctcaaaaaatgtccag
ccttgcacccttgacgatgcaacaaagaacctcatcaagctcatattcagcaatgacatg
ttcaaggaggccatggagtgtatgaacttagacatcaagaaaatgcctttgggcaagctc
agtaagctgcagattgcaaagggctttggagtactggaggaaatcgaggcagccatcaac
caaaaaagcaaaagatcatgtctggaagaactttcctcaaagttctttaccacaatccca
cacaactttggccggaacagaccgccaaccatcgacaaccaagagattgtggaccagaag
aaagagatgcttatggtgctggcagacattgagctcgcccagactctgaagtcagagact
gagaaggctcaggaagagatgatagacacagttcctcaccctctagaccaggactacaac
tctctgaaatgcaagctcacactaatggaaaagggtacaggaacattcaagataatagca
aaataccttaaagagacgtcatgtgactttaatgaaccaaagattgtcaatatttgggaa
gttgatcgagagactgagggacagcgctttagggaacatgataaactggagaaccgtcgt
ctgctgtggcatggcacaaacatagcagtggtggcagctnacggtctgagaataatgccc
cattcaggaggccgtgtcggcagcggtatctatttcgcgtctgaaaacagcaagtccgca
agttatgtgcgcacctctaaacggactggagtgatgtttctgagtgaggtagcccttggc
aaagaatgtaccatcaccaaagacaacagttccctgaagaagcctcctgcaggctatgat
tctgtggtggcacgaggaacagtggaaccggatccctccaaggacatcatcatctgtctg
gatggcaaaaaagttgctgtacctcagggtaaggccattcaacagagccagttctcaaag
agctccttctacaacagtgaatatcttatctacaaagagagccagtgtcgccttcgctac
ctgttggagctgaacatgtcatactaa

DBGET integrated database retrieval system