KEGG   Monopterus albus (swamp eel): 109965158
Entry
109965158         CDS       T05607                                 

Gene name
ahrr
Definition
(RefSeq) LOW QUALITY PROTEIN: aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109965158 (ahrr)
Transcription factors [BR:malb03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109965158 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 109965158
NCBI-ProteinID: XP_020464612
Position
Unknown
AA seq 696 aa
MIPPGDCMYAGRKRRKPIQKQKPSSASEKTNPSKRHRDRLNAELDRLASLLPFPPXELDK
LSVLRLAVSYLRVKSFFQASQEKTSRKHITSTAPSNPEPRKDSLPLCTSINESSLLLESL
TGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMCPLQ
HQGTSAHQDNQTAAGTGDDFVVSSLFYSPEAGGIPPELSCFLNRCFIARVRCLLDSTSGF
LTMQFQGRLKFLHGQKKKSASGALMPSQLALFCTAVPLILPSITEMKMKSMFMRGKNKGG
SGGIISALEHGPLLHSERGEHLRRHSFSGGMGDIADPLLLSCPTPGGTQRGNHSPWTTLA
KDNLKYCPDGYYNQEEPLNYCKPSIGPHKGLSPGLGGGWSLRPNSGPFRAGQGVSYTNSN
RLNKTGQYGKPYRLSPSCHSSRGGEVFVSKLYGNIQIPTDPDAYCVDLVKSEDGYGECYD
DHLMPEMQPIKIEHDSDSENGSDAYGQPWACRDPEAVNRRYNGIYDQSSSLQLKSEADYY
DAQYSPCQQGKTGISPPYNNGNYHSYAVNNSGSTTSRMLKCDKDLGNNDDGNQFSPQRLS
HSDSLCTNQPVNLMDSHIYLQDPHKAYMPPDYNKLGTYDFKGHGLIHSIKREPMDSPPWT
ESGHDVNQSMMAGSRNIMPCVMTTGHHKSSPYIYMS
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgatccctcctggagactgcatgtatgcgggtaggaagaggaggaagcccatccaaaaa
cagaagccgtcctctgccagtgagaagaccaacccgtcaaagcggcaccgggacaggctg
aatgctgagctggaccggctggccagtctgctgccgttccccccgnnggagctggacaag
ctgtccgtgctgcgcctcgcagtttcctacctccgcgtcaaaagtttcttccaagcgagc
caagagaagacgtccaggaaacacatcaccagcacagccccctctaaccctgagcctagg
aaagacagccttccgctgtgcacctccatcaacgaaagcagcctgctcctggaatctctg
acaggctttgccttggtggtgagcagtgatgggatggtcttttatgcctcttcaaccatt
gtggactacctgggttttcatcagaccgacgtgatgcaccagaatgtgtttgattacatc
cacatagacgaccgtcaggagttcagacgccagctccactgggccatgtgtcctctacag
caccaggggacctcggcacaccaggataaccagacagctgcagggactggtgatgatttt
gtagtcagcagcctgttttattctccagaggcggggggaattcctcctgagctctcgtgc
tttctcaacagatgtttcatagccagagttcgatgcctcttggacagcacgtctggattc
ttgactatgcagttccagggccggctgaagttcctccatggacagaaaaagaagtcagcg
tctggggctctgatgccttcccagctggctctgttctgcacagctgtgcccctcatactg
ccctccatcactgagatgaaaatgaagagcatgttcatgcggggaaagaacaagggagga
agtggagggattatctcagcactggagcacgggcctcttcttcacagtgagcgaggggaa
catctccgccggcactccttcagtggaggaatgggtgacattgcagaccctctccttctg
tcatgtccaactcctggcggtacccagcgaggtaaccacagtccttggaccacacttgcc
aaagataacctcaagtactgccctgatggttactacaatcaggaggagcccctcaactac
tgcaagccctccattggtccccataaaggtctcagtccaggtttgggtggtggctggtct
ctgcgaccaaattcaggtcccttcagagcaggtcagggtgtcagctacacgaactctaat
cgcttgaacaagacaggccaatatggaaagccataccgcctttcacctagctgccacagt
agcagaggtggtgaggtatttgtctctaagctctatgggaacattcaaattcccacagac
ccagatgcctactgtgtggacctggtgaagagcgaggacggctatggtgaatgctacgat
gaccacctgatgccagagatgcaacccatcaagatagagcacgactcagactctgaaaat
ggctctgatgcttatggacaaccctgggcttgccgcgacccagaggccgtcaaccgtcgc
tataatgggatttacgaccaaagctccagcctacaactcaaatcagaggcagattattat
gatgcacagtactcgccctgtcagcaagggaaaacaggcatcagcccaccgtacaacaat
ggcaactaccacagctatgcagttaacaacagcggcagtaccacctcacgtatgttaaag
tgtgacaaagacttgggaaataacgatgatggcaaccagtttagtcctcagagactctct
cattcagactctctatgcactaaccaacctgtcaacctcatggactcacacatctatcta
caagaccctcacaaggcctacatgcccccagactacaacaagcttggaacttatgatttc
aaaggtcatggtctgatccattcaatcaagcgggaacccatggactcgccaccatggact
gagagtggtcatgatgtaaaccagtccatgatggctggttcaaggaacattatgccatgt
gtgatgaccacagggcaccacaagtccagtccttacatttatatgtcataa

DBGET integrated database retrieval system