KEGG   Monopterus albus (swamp eel): 109965378
Entry
109965378         CDS       T05607                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:malb03021]
    109965378 (aff3)
Transcription machinery [BR:malb03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     109965378 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 109965378
NCBI-ProteinID: XP_020464981
Position
Unknown
AA seq 1228 aa
MPTVLGGKGKLSVVCFLLRCTYSQVTRNQHNSGAKDILEDMTQSWPSQQALEGDQAQRIL
YNSKDTKQLNTQQRQSRGGVQLRMTRHPHVAPHKSMLADDLKLSSDDDDTHKVNHESASW
DRQSLSVQRAHTHGRRVRHSSSDSSDSDSTAESGSSSLHSRSLSPEVHPEPESPANTQPP
CNNKETNHPSAAQWQLDKWLKKSRKKSASSEQDPSQGVPGHLPSPHIQQAPSPARAWDSN
QEYSPSQSPIPSPQFNYSHNNSPLPSPGYSYCPSPSPFTSTCPSPTPSPRHSPVPSPVLS
VCPSPYGSPSASLSPSPLLRDPPRSPSPSLPPRYRVHHYPELLSQNQKQPGQTAIPHRTK
IRSWINTDTKNKHTNSTHPQPTHHYRPKARPTQNQDQSQSKASTALNSHQGQSHKSRPKS
NFPTNSKQTSDIPKVKHTSHLEQIQGSRSNHKPRPQFQPSSQHSPTRAKHLAPTSRETKT
GHSSDSQAASKAASNSSAGLNSRSSPGLKPRVKSWEATAPTPVHVNQTKTLQKKPQTKEQ
EVDHRGNHLTQSEGRKPERKEDRQKEKQQGKQERKEDRRLAEEQLLRHPWIQSSEEEEGE
EEEEERPVERQRRREETTRGENRRSREQQPRREWQTVQAKQRPPTNVERHHLQDDSHHQG
RAKKGGRTEEERELQPDSSPPLSHSPTPHTPSSSSSASCSSNSDSESEYQALITKVSADS
TSHKRLTKRGQQGPGRPDANKPKAVHPRGPISCNPSDGQQNEGKQKLYTLVPFGRGDQTT
VYSQRGLRNLVVQIDLCLLKRVPDSTTNSTVKPPPSSSCSSSTKDKQREAMKHLAASESV
TIDSKRKRKLENEVSHRQSKRSLPSAGDLSARTESSAHTAEHNFVTETTHNGYLEEYLDS
KRPLSPLSPLSDSPATTKPPSKTKTSEQHHIHAHKHKDKNRDSAVKPKMEVECVKVSKQS
QLPSESWGPTGHRGTVPNHETPHHAEYYLHEAKRMKHRADAMVDKLGKAVNYVDAALSFM
ECGKAMEEGPLEAKSPYTMYSETVELIRYAMKLKSHCGPGARQEDKQLAVLCFRCLALLY
WQMFRLKKDHALKYSKVLLDYFKSSPKVPTTPPCWNDSGKGTGGPASSLSPNAKYQGRGS
HGGSSAPSLISIPQRIHQMAANHLNITNSVLYSYEYWEVADNLAKENKEFFNYLNTLSGP
LTLHSSIAHAVQYTRQALQWIRISAKLN
NT seq 3687 nt   +upstreamnt  +downstreamnt
atgcctactgtcctcggtggcaaagggaaactttccgttgtctgttttctgctccgatgc
acatattcacaggtaacaagaaaccaacacaacagcggtgccaaagatattctggaggac
atgactcagtcctggccatcccagcaagccttagagggtgaccaggctcagcgaatcctt
tacaactcgaaggatacaaaacaactgaatacacagcaaaggcaaagtcgaggaggtgtt
cagctgcggatgacccgtcatcctcacgtggcacctcacaaatccatgcttgctgatgac
ctgaagctgagcagtgatgacgatgacactcataaggtcaatcatgagtcagcttcctgg
gacagacagagcctgtcagtgcagcgagcgcacacacatggcaggcgggtgagacattcc
agttcagactcttcagactccgactccactgctgagtcgggaagcagtagccttcattcc
cggagcctgagcccagaggttcacccagaacccgaatcacctgccaacacgcagccaccg
tgcaacaacaaggagactaatcacccctctgctgcccagtggcagttggataaatggctg
aagaaatctcggaaaaaatcagccagcagtgaacaggatccttcccaaggcgttccaggt
cacctgccctctccccacatccagcaagctccatctccagccagggcctgggacagcaat
caggaatacagccccagccaaagccctattcccagcccacagtttaattacagccacaac
aatagtcccctacctagccctggttacagctactgccctagccccagcccattcaccagt
acctgtccaagtcccacccctagcccgaggcatagcccggtccccagtccagttttaagt
gtttgtcctagtccgtatgggagcccaagcgccagccttagccctagccctttacttaga
gatcctccaagaagcccaagtcccagcctacctcctcgttacagggttcatcactaccct
gaacttctgagtcagaaccaaaaacaacctggtcaaacagccattccccacaggaccaaa
attaggtcatggattaacactgacaccaagaacaagcatacaaatagtactcatcctcag
ccaactcatcattataggcccaaggctcgacccacacagaaccaagaccaaagccaatcc
aaggcttctactgctttaaactctcaccagggtcagagccacaaatcgagacccaagtct
aactttcctacaaattctaaacagacctctgacatccccaaagttaaacacacctcacat
ttagagcaaatccagggtagcagatccaaccacaagcccaggcctcagtttcaacctagc
tcacaacatagccccacaagagcaaagcacttagctcctactagtcgtgaaaccaaaact
ggtcacagttctgattcccaggctgcctctaaagctgctagtaattctagtgctgggttg
aactccaggtctagtcctggtctaaaacctagggtcaaatcatgggaggctacagcacca
actcctgtgcatgttaatcagacaaaaacgttgcagaagaagccccaaaccaaggaacag
gaggtggaccacagaggaaatcatctgacccaatcagaggggagaaaacctgagagaaaa
gaggacagacagaaggaaaaacaacaaggaaaacaggagagaaaggaagacaggaggctg
gcggaggagcagcttctgagacatccctggatccagagttcagaggaagaagagggggaa
gaagaggaggaagagagaccagtagagaggcagaggaggagagaggagacaacaagaggg
gaaaacaggaggagcagggagcagcaacctagacgtgaatggcaaacagtccaggccaaa
cagagaccgcctaccaacgtcgagcggcaccacctgcaggacgactcacaccaccagggg
agggcaaaaaagggaggcagaactgaggaggagagggagttacaaccagactcttcacct
cctctgtcacattctccaactcctcatacaccatcctcctcatcctctgcctcttgctct
tcaaattcagattcagaatctgaatatcaggctttgatcaccaaagtttcagcagactct
acctcccacaagagactcaccaagagagggcaacaaggcccaggcagacctgatgccaac
aagccgaaggcagtgcaccctagaggacccatctcatgtaatccaagtgatgggcagcag
aatgaggggaagcaaaaactctacaccttagtcccatttgggcgaggtgaccagactaca
gtgtattcccagcgaggtcttagaaatctggtggtgcaaatagacctctgtcttctcaaa
agggtcccagacagcactactaattctacagttaagcctccaccctcttcctcctgctct
tcatcaaccaaggacaagcaaagagaggctatgaaacaccttgctgcatctgagagcgtg
acaatagacagcaaaaggaagcgcaagttggagaacgaggtgtcacacagacaaagtaag
aggagtcttcctagtgcaggtgacctctcagcccgtacagagtcttcagctcacacagct
gagcacaactttgtgactgagaccacacacaatgggtacttggaggagtacttagacagc
aagaggccgttgtctcccctgtctcctctgtccgacagccccgcgaccaccaagcctccc
tccaaaacaaagacttcagagcagcaccacatccacgctcacaagcacaaagacaagaac
agagattctgctgtgaagcccaagatggaggtggaatgtgtaaaagtgtcgaaacagtcc
caactaccctccgagtcctggggccctacaggacacagggggaccgtgcctaaccatgaa
actccacatcatgctgagtactacttacatgaagccaaaaggatgaaacaccgtgctgat
gcaatggtggacaagctggggaaggctgtgaattacgttgacgctgctctctccttcatg
gaatgtgggaaagcaatggaggaagggccactcgaggccaaatctccttacaccatgtac
tcagagacagtggagctcatcaggtatgcaatgaagctgaagagccactgtggccctgga
gcgaggcaggaagacaaacagctggcagtactatgtttccggtgccttgccctactatac
tggcaaatgtttcgtttaaagaaggatcacgcactgaaatactccaaagtgctactggac
tattttaagagttctcccaaagtgcctacaacaccaccctgttggaatgactctggaaag
ggtacaggaggacctgcgtcttcgctctcacccaatgccaaataccaaggacgaggttca
catgggggcagcagcgccccctctctcataagcattccccaacgtatccaccagatggca
gcaaatcacctgaacatcaccaatagtgtcctgtacagctatgagtactgggaggtggca
gacaaccttgcaaaggagaataaagaattcttcaactacttgaatactttgtctgggcct
ttgactcttcacagcagcattgctcatgcggtccagtacaccagacaggctcttcagtgg
atacgcattagtgccaaacttaactaa

DBGET integrated database retrieval system