KEGG   Monopterus albus (swamp eel): 109965533Help
Entry
109965533         CDS       T05607                                 

Definition
(RefSeq) TGF-beta receptor type-1-like isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04060  Cytokine-cytokine receptor interaction
malb04068  FoxO signaling pathway
malb04144  Endocytosis
malb04218  Cellular senescence
malb04350  TGF-beta signaling pathway
malb04371  Apelin signaling pathway
malb04520  Adherens junction
malb04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109965533
   04350 TGF-beta signaling pathway
    109965533
   04371 Apelin signaling pathway
    109965533
   04068 FoxO signaling pathway
    109965533
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109965533
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109965533
  09143 Cell growth and death
   04218 Cellular senescence
    109965533
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109965533
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109965533
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109965533
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109965533
Protein kinases [BR:malb01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   109965533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 109965533
NCBI-ProteinID: XP_020465265
Position
Unknown
AA seq 500 aa AA seqDB search
MDAISCLILVLLFGTGIPENAALQCYCDRCSVNSSCTTDGVCFVSLRMSGNRAITERRQC
IRENELIPRDRPFICAPSAKQDIGIYPICCTTDYCNKDPDPIKITVPTEKPPSLGPVALA
AVIAGPVCVFCLLLVVAFYVCHSHRGLAAGGAGAHHHHHHCVPNEEDPSMDHPFITVGTT
LKDLIYDMTTSGSGSGRRSGSGLPLLVQRTIARTIILQESIGKGRFGEVWRGKWRGEEVA
VKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFD
YLSLSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATD
TIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIASRCSMGGIHED
YQLPYYDLVQSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARL
TALRIKKTLSQLSQQEGIKM
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgatatcgtgtttaatacttgttcttctcttcgggacagggataccagaaaat
gccgctctccagtgttactgtgaccgctgcagcgtcaactccagctgtacgacagatggt
gtctgttttgtctccctccgcatgtcgggcaaccgggcgattaccgagcggcgccagtgc
atacgtgaaaatgaactgatcccacgagaccggcctttcatctgtgccccatccgccaaa
caggacataggcatttacccaatatgctgtaccacggactactgcaacaaagaccccgac
cccataaagataactgtccccacagaaaagcctccttctctgggccctgtagctctcgca
gcagtgattgccggcccggtgtgtgttttctgcctgctgcttgttgtggcgttttatgtt
tgccacagccacaggggtctggcagcaggtggtgctggggcccaccatcaccaccaccat
tgtgtgcccaatgaagaggacccatccatggatcatcccttcatcactgttggaacaact
ctaaaggacctcatctacgacatgaccacctctggctctggatcaggtaggcgctctgga
tcaggtctgccgctgctggtccagaggaccatcgccaggaccatcatcctccaggaaagc
attggtaaagggcgtttcggggaagtgtggcggggcaagtggcgtggtgaggaggtggcc
gtgaagatcttctcctcccgtgaggagcgttcctggttccgcgaggctgagatctaccag
accgtgatgctaagacacgagaacattcttggcttcatcgctgctgacaacaaggataat
gggacatggactcagctgtggctggtgtcagattatcatgaacacggctctctgtttgac
tacctctccctgtctacagccagcggccttgcccacctccacatggagatagtgggcacg
caaggtaagccagctattgctcacagagacctgaagtcaaagaatattctagtgaagaag
aatgggacctgctgcattgccgacctgggtttagctgtccgccatgactcagccactgac
accatcgatattgctccaaaccacagagtgggaaccaaaaggtatatggcccctgaggtc
ctggatgactccattaacatgaaacactttgagtccttcaagcgagctgacatctatgcc
atggggctggtgttctgggagattgccagccgctgctctatgggaggcatccatgaagac
taccagctgccctactacgacctggttcagtcagatccatcagtggaggagatgaggaaa
gtggtttgtgagcagaaacttcggcccaacattcccaaccgctggcagagctgtgaggcc
ttgcgagtgatggcaaagataatgagggagtgttggtatgccaatggtgccgcccgactc
accgctctccgaatcaagaaaaccctgtctcagctcagccaacaggagggaatcaagatg
tag

DBGET integrated database retrieval system