KEGG   Monopterus albus (swamp eel): 109965610Help
Entry
109965610         CDS       T05607                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04020  Calcium signaling pathway
malb04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109965610
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109965610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:malb04030]
    109965610
G protein-coupled receptors [BR:malb04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    109965610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Gaa1
Motif
Other DBs
NCBI-GeneID: 109965610
NCBI-ProteinID: XP_020465418
Position
Unknown
AA seq 438 aa AA seqDB search
MATASPQQLLDDVINTEQQQHPQEEEEVLSSLEATLLTIFLSIIIIMTVFGNLLVMVALC
KDRHLRKTKTNYFIVSLAFADLLVALVVMPLAAIELTTGRWQYGKIFCLVRTSLDVLLTT
ASILHLCCIALDRYYAICCQPLVYRHKMTPVRVAVMLSGCWLIPTFISFLPIMQSWNAIG
IEDIIEERRVLRGGPNDTSCVFLVNWPYALICSAVAFYIPLALMVLAYQRIYVTAMTHVR
QIEMLQRAGSAPVTGTIPVITVSPSTSTDPVEYYCLRTTTGSSSSEQSPVSNSHMRVETK
AAKTLAVIMGCFCLCWAPFFITNVVDPFIHYTVPWQLWTAWLWLGYINSGLNPFLYAFLN
RAFRRAFLVILCCGDERYTRQGSCSYGHTQGACSAASVNGTSMARRLSLLPNRSYSDNGR
MVLANEHESQDSLRPPRS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcatcacctcaacaattgttggatgacgtgataaacacagaacaacagcag
cacccgcaggaggaggaggaggtcctaagctcactggaggctacacttcttaccatcttt
ctctccatcattattatcatgacagtatttggaaacctactggtcatggtcgctctctgc
aaggacagacatttacggaagacaaagaccaactacttcattgtgtccctggcatttgct
gacctgcttgttgcactggttgtgatgccactcgctgcaattgagttaaccaccggccgg
tggcaatacggaaagattttctgcctggtccggacgtctctggacgtcctgttaactaca
gcatccatcctccacctctgctgcattgcactggacaggtattatgctatctgctgccag
ccactagtctacagacacaagatgaccccggtgagagtggctgtgatgctcagtggctgc
tggctcatcccaacattcatctccttcttacccatcatgcaaagctggaatgctattggc
atcgaggacattattgaggagaggcgagttttgagaggcggccccaatgacacaagctgt
gtatttctggtcaactggccttacgcactcatctgttctgcggtggctttctatatccca
ttggccctcatggtcctggcctatcagcgtatctatgttactgccatgacccatgtgagg
caaattgagatgctacaacgtgctggctcagctcccgttaccgggacaattccggtcatc
actgtgagcccatccacttccacagatccagtggagtattactgcctcagaacaacaaca
ggttcctcctcctcagagcagtctcctgtatcaaacagccacatgcgtgttgagacaaaa
gcagcaaagacactggcagttataatgggttgtttctgcttatgttgggcaccattcttc
atcaccaacgtggtggacccctttattcactatacagtgccctggcagctgtggaccgcc
tggctatggcttggctacattaactcagggttgaacccctttttgtatgccttcttgaac
cgggcatttcggagggcctttctggtgatcctctgctgtggagatgagcggtacacacgg
caggggagctgctcctatggacacacccaaggagcgtgctcagcagcgtcggtcaatggg
acatctatggcacggagattgtccttactgccaaaccggagctacagtgacaacggacga
atggtactggcaaatgagcacgagtcccaggactctcttagaccaccacgaagctga

DBGET integrated database retrieval system