KEGG   Monopterus albus (swamp eel): 109965934Help
Entry
109965934         CDS       T05607                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109965934
Membrane trafficking [BR:malb04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109965934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 109965934
NCBI-ProteinID: XP_020466015
Position
Unknown
AA seq 2107 aa AA seqDB search
MTERRAFAHKISRTVAAEVRKQVSREYGSPQLSKKRGCAHHPLPLTEVVEPVDFEEYVSS
HAPGVEPSPLRQLMEFPQDDLELLQLDKECTTLEPPLPEEEDSLDPRVRDALAIYTDDWL
IIQRKYQRYSTIYTPHSSERQRERQRGLVKQTFEMDEVAERQDDQDDAKRRSVSLDETPR
GSWASSIFDLKNSSPDALLPSVLERTAAEDMDRRNTEARLQGRHSDLLGLYAPPDEDEAV
ERCSVPEVPKEHYGQRIMVKCLSLKFEIEIEPIFGTLALYDVKEKKKISENFYFDLNSDQ
MKGLLKPHTPHAAISTLARSAIFSITYPSADIFLVIKLEKVLQQGDIGECCEPYMVMKES
DSSKHKEKLEKLRLQAEQSCSRLGRFRMPFAWTAIHLVNIVSSVGGLDRSDSDSDSERKG
LGTWNERKKKGFERMSVGDDMCNFATFRPATLTVTNFFKQEGDRMSDEDLYKFLADMRRP
SSVLRRLRPVTAQLKIDISPAPDSPHYCLSPELLHAKPYPDLRVRPTKEVLEFPARYVYT
PHTTYRNLLYVYPKSLNFSSRQGSVRNIAVKVQFMAGEDLSQALPVIFGKSSCAEFMNEA
YTPVIYHNKSPEFYEEIKMKIPANLTDNHHLLFTFYHISCQTKQNTPLETPVGYTWIPLM
QHGRLRTGSFSLPVSVEKPPPSYSVLTPDVQLPGMKWVDNHKGVFNVEVTAASSVHTQDP
HLDKFFTLVYVLEEYSFPFRLKDVIITEANMEGELKTSMAALRGALLDTCVRFLHQLLSK
LIQLIVYPPVIAGQIVNLGRAAFEAMALLVNQVHKNLEGNQDQHSRNNLLASYIHYCFRL
PTAEPTIPPTASTQSYEMTMQYATLSRATARPSSLHLSRSKSISNSNPDLASTPVTPDEE
VQRIMGSKGIDRSHSWVNSAYAPGGSRSVLRRNPNSSCELKQANDRSSNRMSAILDSMAL
FSVPTRQITKKLLHEELALQWVVSTSTVREATLQQAWFFFQLMTKSMAHHLFLNSKLEVP
RRQRFPDRFVDDIAALVCAISADIASRYHKDVELVERLNSSLAFFLNDLLSLMDRGFVFN
LIRSYYKQIANKLHTAQNPSTLNALRMDFIRIVCSHEHYVILNLPCSTLSPPASPSPSTS
STTSQSSAFSSMVQDQGVATMFELSVPFRQQHFLSGLLLSELSLMLDPDGEGVFFLHKKA
ISAVHSLLCSHDADPRYVDPQVRAHVAQLYLPLIPIVMETLHQLHDFSDSSPTRVRSAYA
DDADPDSSNTISQSVAMAIAGSPLPHAKASSFALPIVAGRQSNSLSAECSRTLLVCFLWV
LKNADAALLEGWVSDLSVLQINRLLDLLHLCVSCFEYKGRKTLERINSLTFKKSQDMKAR
LEEAILGTIGARQEMVRRCRERSPYGSQENVRWRKNVTHWRQNTDRVDKTKAEVEQESVV
DGNLATEASLIVLDTLEIIVKTVVASELKESVLGGVLRVLLHSMAGNQSALFLQHCFTTQ
RALVYKFPEMLFEEDTELCADLCLRLLRHCSSSVGSVRSHASASLYLLMKQNFEIGNNFA
RVKMQVTMSLSSLVGLSQNFNEEHLRRSLKTILTYAEEDMGLRDTPFREQVQDLVFNLHM
ILTDTVKMKEHQQDPEMLIDLMYRIAKGYQNSPDLRLTWLQNMAGKHSERGNHAEAAHCL
VHSAALVAEYLSMLEDCRYLPVGCVTFQNMSSNVLEESAVSDDILSPEEEGICAGKYFSE
SGLVGLLEQAAASFNMAAMYEAINEVYKILLPIHEANRDFKKLATVHGKLQDAFNKVYNQ
SSGWERMFGTYFRVGFYGCRFGDLDDQEFVYKEPSITKLAEISHRLEEFYSESFGDEVVE
IIKDSSPVDKTKLDLNKAYLQITYVEPYFDTYELKERITYFDKNYNLRTFMYCTPFTLDG
RAHGDLHEQYKRKTILTTSHAFPYIKTRINVIHKEEIILVPIEVAIEDMQKKTQELAFAT
NQDPADSKMLQMVLQGCVGTTVNQGPLEVAQVFLSDIPDDPKLFRHHNKLRLCFKDFSKR
CEDALRKNKALIGPDQKEYHRELERNYNKLKEALGPLINRKIPQLYRTLPAQAAQTQRNS
YSRSSLR
NT seq 6324 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaggcgggcgtttgctcataaaatcagccggacagttgctgcagaggtcaga
aaacaagtgtccagagagtatggctctcctcagctgtccaagaagcgaggctgcgcacac
caccctttgcccctgacggaggtagttgagcctgtggattttgaagagtatgtgagcagt
catgcccctggggtggagcccagcccgctcagacagctcatggagttcccccaggatgac
ctggagctcctccagctggacaaagagtgcactacactggagcccccactgcccgaagag
gaagactcactggatcccagggtgagagatgccttggccatctacacagatgactggctc
atcattcaaagaaagtaccagcgctacagcaccatatacacccctcacagctctgagcga
cagagggagaggcagcgagggctggtcaaacagacttttgaaatggacgaggttgctgag
cgccaggacgaccaggatgacgcaaagcggcggtcagttagccttgatgagaccccaaga
ggcagctgggcctccagcatctttgacctgaagaactcctcgccggatgctctcctgccg
tctgtgctggaacgtacagctgcagaggacatggaccgccgcaatacagaggcacgcctg
cagggccgccacagtgacctgctgggcctctatgctcccccagatgaggatgaagcagta
gagagatgctctgttcccgaagtacccaaggaacattatggccagcggatcatggttaaa
tgtctgtctctgaagtttgaaatagaaattgagccaatatttggcactcttgccctctat
gatgtcaaggaaaagaaaaagatctctgagaatttctacttcgacttgaactcggatcag
atgaaagggctgcttaaaccccacacacctcatgcagccatatccacactggcccgttct
gccattttctccattacatacccttctgctgatatcttcttggtcattaagcttgagaaa
gtcctccaacaaggagacattggagagtgctgtgaaccctacatggtcatgaaagaatct
gattcctccaagcacaaggagaagctggagaagctgcgtctgcaggcagagcaatcctgt
agtcgtctcggtcgttttcgcatgccttttgcatggacagccattcaccttgtcaacatt
gtcagcagtgtgggaggtctggatcggtcagattctgactcggactctgagcgaaaaggt
cttggaacatggaatgaaagaaagaagaaggggtttgagcggatgagtgttggggatgat
atgtgtaactttgccaccttccgtccagcaacgttgactgtcaccaacttcttcaaacag
gagggggacaggatgagtgatgaggacctctacaagtttctggcagatatgcgcagaccg
tcatctgttctgcggagactgaggcccgtcacagcccagttgaagatcgatatctctcca
gctccagactcgcctcattactgtctgtcaccggagctgcttcatgcgaagccttatccc
gacttgcgtgttcgcccaaccaaagaggtgttggagtttcctgcccgctatgtatacaca
ccgcacaccacctacaggaatctgctctatgtttaccctaaaagtctgaacttcagcagt
cgccagggatcagtgcggaacattgctgtgaaggttcagttcatggcaggagaggacctc
agtcaagctttgccagtcatatttgggaagtcaagttgtgctgagttcatgaatgaggcg
tacactcctgtcatctaccataacaagtcccctgagttctatgaggagataaagatgaag
attcctgccaatctgacagacaaccaccatctgctgttcaccttctaccacatcagctgc
cagaccaaacagaacactcctctggagacccctgttggctacacttggatccctttgatg
cagcatggccgactacgcaccggctccttcagtctgcctgtctctgtggaaaagcctcct
cctagctactctgtactcacccctgatgttcagctcccaggcatgaagtgggtggataat
cacaaaggagtgttcaatgtcgaggtgacagcggcctcctctgttcacactcaggacccc
cacctggataagttcttcactctagtgtatgttctggaggagtactccttccccttccgc
ctgaaggatgttatcataacagaggcaaacatggagggggagctgaagaccagcatggct
gctctaagaggggctctgctggatacatgtgtcaggttcctgcaccagctgctgagcaag
ctcattcagctcatcgtatacccaccggtcattgcaggccagattgtgaacctgggccgt
gctgccttcgaagctatggctttgttggtcaaccaggtacacaagaacctggaaggtaac
caggaccagcacagccgcaacaatctgttggcatcctacatccattactgcttccgcctg
cccactgccgaacctacaatacccccaacagcaagcactcagtcctacgagatgactatg
cagtacgccaccttatcgagagcaacagcccgccctagcagcctgcacctgtctcgttcc
aagagtataagcaactccaaccctgacctggccagtacaccagttactcctgacgaagag
gtgcaaaggatcatggggagcaagggcattgaccgctcacactcctgggtaaactctgct
tatgcccccgggggctccagatctgtgctacgccggaacccaaactccagctgtgagctc
aagcaggccaatgaccgcagcagcaatcgcatgtctgccattctggacagcatggccttg
ttttcagttcccacaaggcagattaccaaaaagctgctccatgaggagctggcattacag
tgggtggtcagcacgagcacagtgagggaagcaaccctgcagcaggcctggttcttcttc
caacttatgacaaagagcatggcccatcacttattcctgaactcaaaactggaagttccc
aggcgtcagcgtttcccagaccgctttgtagatgacatcgctgcacttgtgtgtgccatc
agtgccgacattgctagccgataccacaaggatgtggagcttgtggagaggttaaacagc
agtctggccttcttcctgaatgacctgctttctctcatggaccggggctttgtgttcaac
ctcatccgctcctactacaaacagattgccaacaagctccacacagcacagaaccccagc
actctaaatgcactgaggatggacttcatacgtattgtctgcagccacgagcactatgtc
atcctcaacctgccctgttcgactctcagtcctccagcttctccctccccctccacctcc
tccaccacatcacagagttcagcattttccagtatggtgcaagaccagggtgtggccacc
atgtttgagctctccgtcccttttcgccagcagcactttttgtctggcctgctgcttagt
gagctctctctcatgcttgatcctgatggagaaggggttttcttcctacataaaaaggcc
attagtgctgttcactccctgctgtgcagccatgatgcagaccctcgctacgttgaccct
caggtcagagcccacgttgctcagctctacctgcccctcattcccattgttatggagacg
ttgcatcagctccatgacttctctgactcctcgcctactcgggtccgctcagcctacgcc
gatgatgctgacccagacagtagcaacactatcagtcagtctgttgccatggcgattgcc
ggctcccctttgccacatgccaaagccagctcatttgctctgcccattgtggctgggcgc
cagtccaactctctgtctgccgagtgcagcaggactctgctggtgtgtttcctgtgggtg
ctgaagaatgcagatgcagctctcctggagggctgggtgtctgatttgtctgtattgcaa
atcaaccgcctactggatctgctgcatctctgtgtgtcctgctttgaatacaaggggagg
aagactctggagaggatcaatagcctgacgtttaaaaagtctcaagacatgaaggctcga
ctggaggaggccatactgggcaccattggagctcgtcaggagatggttcgccgctgcaga
gaaaggagtccctatggcagccaagagaatgttaggtggagaaagaatgtcactcactgg
agacagaacacagacagagtcgataagactaaagctgaggtggagcaggagtctgtggtg
gatggaaacctagccactgaggcctctctgatagtcctggacacacttgagattatagtc
aagactgtggtggcatcagagttgaaggaaagtgttttaggtggggtgctgagagtgctt
ctccacagcatggcaggcaaccagagcgccctcttcctgcagcactgtttcactacacag
agggctctggtttataagttcccagagatgctgtttgaagaggacacggagctttgtgca
gacctgtgtctgcgtctccttcgccactgcagcagtagtgtcggctctgtcagaagccat
gcctctgcatctctgtacctgctcatgaaacagaactttgagattggaaataactttgca
cgagtgaagatgcaggtcaccatgtctctgtcctcgctggtgggattgtcacagaacttc
aatgaagagcatcttcgtcggtcactcaagacaattctgacgtatgctgaagaggacatg
gggctgcgtgacacgccttttcgagagcaagtccaggatctggtgttcaacctgcacatg
attctgactgacactgtgaagatgaaagagcatcagcaggacccagagatgctcattgac
ctaatgtacaggattgccaagggctaccagaactccccagacctgcgtctgacatggctc
cagaacatggcagggaagcactctgagagagggaaccacgctgaggctgcccactgtctg
gtccacagcgctgcactggtggcagaatacctcagcatgctggaggactgccgctatctg
ccagttggttgtgtcacgtttcagaatatgtcatccaacgtattggaggaatcggcagta
tccgatgacatcctgtctccagaggaggaggggatttgtgctgggaagtacttcagtgag
tccggcctggtgggcctcctggagcaggcagctgcatcttttaacatggcagccatgtac
gaggccataaatgaagtgtacaagattctgctgcccatccacgaagccaacagagatttc
aaaaagctggccactgttcatggaaagctacaggacgccttcaacaaagtatacaaccaa
agctcagggtgggagagaatgtttgggacctacttcagggtgggtttctatggctgtcgg
tttggagacctggatgatcaagagtttgtctacaaggagccatcgatcaccaaattagct
gagatctcccacagacttgaggagttctactcagagagttttggggatgaggtggttgaa
attatcaaggactccagcccagtggacaaaaccaaactggatcttaacaaggcctacctc
cagatcacctacgtcgagccatacttcgatacctacgagctaaaggaaagaatcacctac
tttgacaagaactacaacctgcgtaccttcatgtactgtactcccttcactctggacggc
cgagctcacggcgacctgcacgagcagtacaaacgcaaaaccatactgacgacatctcac
gccttcccttacatcaagacgcgcatcaatgttatccacaaggaggagatcattcttgtc
cctatagaggtagccattgaggacatgcagaagaagactcaggagctcgcctttgccaca
aaccaagaccctgcagactcaaagatgctgcagatggtgctgcagggctgtgtgggcacc
accgtcaaccagggcccccttgaggtggcgcaggtctttctatccgacattcctgacgac
ccgaagctgtttcgccatcacaacaaattgcgactctgctttaaagatttctccaagagg
tgtgaagatgccctgaggaagaataaagccctgattggaccagatcagaaggagtatcac
agagagctggagaggaactacaataaactgaaagaagcactgggtcctctcatcaaccgc
aagatcccccagctatacagaaccctgccagctcaggctgcacaaacacagcggaactcc
tacagtaggtccagtcttcgttga

DBGET integrated database retrieval system