KEGG   Monopterus albus (swamp eel): 109966257Help
Entry
109966257         CDS       T05607                                 

Gene name
sphk1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00600  Sphingolipid metabolism
malb01100  Metabolic pathways
malb04020  Calcium signaling pathway
malb04370  VEGF signaling pathway
malb04371  Apelin signaling pathway
Module
malb_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    109966257 (sphk1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109966257 (sphk1)
   04371 Apelin signaling pathway
    109966257 (sphk1)
   04020 Calcium signaling pathway
    109966257 (sphk1)
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     109966257 (sphk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 109966257
NCBI-ProteinID: XP_020466626
Position
Unknown
AA seq 493 aa AA seqDB search
MLDFVTLKPVWAPDCQRRALHFARIILSGEICGRVWLLLYLKSTHVPVSLLRCPLRMDQR
RVEPNQNTSTNLVTLYGEFTVTGIRKVRCAVSLTDKDLIVQRLTSAPAERNRLVFSLKDC
VGCRAYRANDSSDPAAYLAVYFYLQKRRWVSSGVSRQRVERCFRLSALQDPCANQEEAEK
WARAVRERSAQQHHLRDGMLMSELSRPFRMMLMVNPQSGKEKALALYNHHIQRMLNEANI
SHTLVITERQNHARELVREADLSQWDALVILSGDGLLFEVINGLLERPDWEEAIRTPLGI
LPGGSGNALAASIHHYSGASPVFSEKLLVSCGFLLCKGLVSPMDLVSIHLSSSPRVFSFL
SLAWGFIADVDIESEKYWVVVQEEDFVLVLALYQSHLAEDLLAAPDAALNDGIIHLFYIR
AGISRVALLRLLLAMEKGAHLATSCQHLVHTKVQALRLEPYSPKGIMTVDGEVVEYGPVQ
AEVHRGLARLISG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcttgattttgttaccctaaaaccggtctgggcaccagactgtcagagacgtgcgctc
cactttgctcgcatcattctgtccggtgagatatgtggccgtgtgtggctgctcctttat
ctcaaatccacccacgtcccggtctcactactccggtgtccactcaggatggatcagagg
agagttgaaccgaaccaaaacaccagtaccaacctggtcacgctgtacggggaatttacg
gtcaccggcatccgaaaagttaggtgtgctgtgagcctgaccgataaggacctcattgtc
cagaggctcacatcggcacctgccgagcggaacaggctggtgttcagtttgaaggactgc
gttggctgccgggcttaccgggcgaatgacagctcggacccggcagcgtacttagcagtt
tacttctacctgcagaaacggcgctgggtgagttccggggtgtcgcggcaaagagtggag
cggtgctttcgcctctctgcgctccaggacccgtgcgctaaccaggaggaggcggagaag
tgggctcgcgctgtccgagaacgctctgcacagcaacaccatcttagagacgggatgctg
atgagtgagttgtctcgtccatttcggatgatgctgatggtgaatccacagagtgggaaa
gaaaaggcgctcgccctgtacaaccaccacatccagcggatgctaaatgaggccaacatc
tcacacacactggttattactgagcgacagaaccacgctcgggagctggtgagagaggcc
gacctgtcacagtgggatgcgttagtcatcttgtcaggagatggactcctctttgaggtg
ataaatggtctgctggagagaccagactgggaggaagccatccgtaccccactgggtatc
cttcctggtggatcaggcaacgccttggctgcatccatacaccactactctggagcctca
ccggtcttcagtgagaagctcctggtcagctgtggtttcctgctctgtaaaggactggtg
tccccgatggatctggtctccatccatctctcctccagccctcgtgtcttctccttcctg
tcactggcctggggcttcatagcggacgttgacatagagagcgagaagtattgggtggtg
gtgcaggaggaagactttgtcctcgtgctggcattgtaccagtcccacctggcagaggac
ctgctggcagcaccagacgctgccttgaatgatggtatcatccatcttttctacattaga
gcaggtatatcacgcgttgcattgctgaggctgttgttggctatggagaagggcgcacat
ctagctaccagctgccaacatctggtgcacactaaggtgcaggcactgaggctggaacca
tattcacccaaagggataatgacagtggacggagaagtggtggaatatgggccggtgcag
gcagaggtgcacagaggcctggcgagattaatcagtggctga

DBGET integrated database retrieval system