KEGG   Monopterus albus (swamp eel): 109967559Help
Entry
109967559         CDS       T05607                                 

Definition
(RefSeq) heat shock 70 kDa protein 1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb03040  Spliceosome
malb04010  MAPK signaling pathway
malb04141  Protein processing in endoplasmic reticulum
malb04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109967559
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109967559
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109967559
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109967559
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109967559
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:malb03041]
    109967559
   03009 Ribosome biogenesis [BR:malb03009]
    109967559
   03110 Chaperones and folding catalysts [BR:malb03110]
    109967559
   04131 Membrane trafficking [BR:malb04131]
    109967559
   03051 Proteasome [BR:malb03051]
    109967559
   03029 Mitochondrial biogenesis [BR:malb03029]
    109967559
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109967559
Protein phosphatases and associated proteins [BR:malb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109967559
Spliceosome [BR:malb03041]
 Complex B
  Other components
   Prp19 complex
    109967559
 Complex C
   Prp19-CDC5 complex
    109967559
Ribosome biogenesis [BR:malb03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109967559
Chaperones and folding catalysts [BR:malb03110]
 Heat shock proteins
  HSP70 / DNAK
   109967559
Membrane trafficking [BR:malb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109967559
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109967559
Proteasome [BR:malb03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109967559
Mitochondrial biogenesis [BR:malb03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109967559
Exosome [BR:malb04147]
 Exosomal proteins
  Proteins found in most exosomes
   109967559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A MetOD2
Motif
Other DBs
NCBI-GeneID: 109967559
NCBI-ProteinID: XP_020468877
Position
Unknown
AA seq 640 aa AA seqDB search
MSAAKGVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VALNPSNTVFDAKRLIGRKFDDPVVQADMKHWPFKVLSDGGKPKIQVEYKGENKAFYPEE
ISSMVLVKMKEIAEAYLGHKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGKTGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMV
NHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLYEGIDFYTSIT
RARFEELCSDLFRGTLEPVEKALRDAKMDKAQIHDVVLVGGSTRIPKIQKLLQDFFNGRE
LNKSINPDEAVAYGAAVQAAILTGDTSGNVQDLLLLDVAPLSLGIETAGGVMTSLIKRNT
TIPTKQTQVFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELAGIPPAPRGVPQIEVTF
DIDANGILNVSAVDKSTGQENKITITNDKGRLSKEEIERMVQDADKYKAEDDIQREKIAA
KNSLESYAFNVKSSVQDEKLRDKMSEEDRKKVIEKCDEAIMWLENNQLAEKEEYQHKLKE
LENVCNPIISKLYQGGMPTGSTCGQQARAGAEGPTIEEVD
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagctaaaggtgtagcgatcggcatcgacctgggcaccacctactcctgcgtg
ggggttttccagcacgggaaagtagaaatcatcgccaacgaccagggcaacaggaccacc
cccagctatgtggccttcactgacaccgagaggctcattggggacgcagccaagaaccag
gtggctttgaaccccagcaacactgtgtttgatgccaagagactgattggaaggaagttt
gatgatccagtggtgcaggctgacatgaagcactggcccttcaaggtgttgtcagatgga
gggaagcccaaaattcaggtggaatacaaaggggagaacaaagccttctaccctgaggag
atttcctccatggtcctggtgaagatgaaggagattgctgaggcttacctcggccacaag
gtgtccaatgcagtcatcacagtcccggcgtacttcaatgactcccagcgacaggcgact
aaagacgcaggcgtcatcgcgggactgaatgtcctgagaatcatcaatgagccgacggca
gccgccatcgcatacggtctggacaaaggcaagacaggagagcgcaacgtcctgatcttt
gacctgggtggaggcaccttcgacgtgtccatcctgacaattgaagacggcatctttgag
gtgaaagccacagctggggacactcacctgggtggagaggactttgacaaccgcatggtc
aaccactttgtggaggagttcaagagaaagcacaagaaggacatcagccagaacaagaga
gccttgaggaggctgcgcacagcctgtgagagggccaagaggaccctgtcctccagctct
caggccagtattgagattgattctctgtatgaaggcatcgacttctacacctccatcacc
agggctcgctttgaggaactgtgctccgacctgttcaggggaacactagagccggtggag
aaagccctgagggacgccaaaatggacaaggcacagatccacgacgtcgtcctggtggga
ggctccaccagaatccccaaaatccagaaactcctgcaggatttcttcaatggcagagag
ctgaacaaaagcatcaacccagatgaggcggtggcttacggcgctgccgtccaggccgcc
attctcacaggtgacacctcagggaacgttcaggacctgctgctgctggatgtggcgcct
ctgtccttgggtattgagacagctggaggagtcatgacgtccctgattaaacgcaacacc
accattcccactaaacaaacccaggtcttcaccacctactctgacaaccagcctggggtc
ctcatccaggtctatgaaggggaaagagccatgacaaaggacaacaacctgctgggcaag
tttgagctggcaggaatcccacctgctccacgaggggtcccacagatcgaggtcaccttc
gacattgatgccaacggcattttgaacgtgtctgcggtggacaaaagcactggccaagag
aacaagatcaccatcaccaacgacaagggccgactgagcaaagaggagatcgagaggatg
gtgcaggacgctgacaaatataaagctgaggacgacattcagagggagaaaatcgctgcc
aagaactcactggagtcctatgccttcaacgtcaaaagcagtgtgcaggatgagaagttg
agggacaaaatgagtgaggaggacaggaagaaggtgattgagaagtgtgatgaggccatc
atgtggctggagaacaaccagcttgctgagaaagaggagtaccaacacaagctgaaagag
ctggagaacgtgtgtaaccccatcatcagcaagttgtatcagggaggaatgcccactggt
agcacctgtggacagcaggcacgagctggagctgaggggcctactattgaggaggtagat
tga

DBGET integrated database retrieval system