KEGG   Monopterus albus (swamp eel): 109967837Help
Entry
109967837         CDS       T05607                                 

Gene name
pah
Definition
(RefSeq) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00360  Phenylalanine metabolism
malb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
malb00790  Folate biosynthesis
malb01100  Metabolic pathways
malb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    109967837 (pah)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    109967837 (pah)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    109967837 (pah)
Enzymes [BR:malb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     109967837 (pah)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT ACT_5 ACT_4
Motif
Other DBs
NCBI-GeneID: 109967837
NCBI-ProteinID: XP_020469345
Position
Unknown
AA seq 633 aa AA seqDB search
MAQHVHFQDIGDDDIPPAPDREDLRILRAEIDTMRARNDTMRARVHAMNAGLDIAIAGLR
GVLDDIPPARDVGEIGDEMPHQMQINLGEVREHLRITRARMDAMEAGMDIGIAGLRAVLD
DISPARDVGEMGDGMPHQMQINLGEAREHLRIMRARMDVARAGLRGAPDDIPPAPAAADI
APMHLFCAQENKGEAEQLAVWCGHIILELNTKSEVISCIFSLKEEVGALARALRLFEEKG
ITLTHIESRPSQANKDHYEFFISVDSTSSQALDEVINSLRTQISGHVHELSRNKQKDTVP
WFPNDIPDLDRFANQILSYGSELDADHPGFTDPVYRARRKEFADIAYNYRHGQTIPRMEY
TEDEKATWGTVFKELKSLYPTHACREHNRVFPLLEKYCGYRPDNIPQLEDVSRFLQSCTG
FRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHSSKPTYTPEPDICHELLGHVPLFADPSF
AQFSQEIGLATLGAPDEYVEKLATVYWFTVEFGLCKQGSEIKAYGAGLLSSFGELQYCLT
DKPKLQPFDPDKTSLQKYPITEYQPVYFVAESFEDAQEKVRKFAATIPRPFTVRYNPYTQ
SIDVLDNTQQLRSLADSISNELGKLCEALRKLQ
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcacgtccattttcaggatattggagacgacgacatacctccggctccagat
agggaggatctgcgtattttgagagcagaaattgatactatgagagcaagaaatgatact
atgagagcaagagtgcatgctatgaacgcaggactggatattgcgatagcaggattgaga
ggggtcttggacgacatacctccggctcgggatgttggagagattggggacgagatgcct
catcaaatgcaaataaatttgggtgaggttcgggagcatctgcgtattacgagagcaaga
atggatgctatggaggcaggaatggatattgggatagcaggattgagagcggtcttggac
gacatatctccggctcgcgatgttggagagatgggggacgggatgcctcatcaaatgcaa
ataaatttgggtgaggctcgggagcatctgcgtattatgagagcaagaatggatgttgcg
agagcaggattgagaggggcccccgacgacatacctccggctccggccgccgctgacata
gctccgatgcacttattttgtgcacaagaaaacaaaggagaggctgaacagctggccgtg
tggtgtggtcacatcatcctggagctgaacactaagtcagaagtgatctcctgcatcttc
tctctgaaagaggaggttggagctttagccagggccctgcggctctttgaggagaagggc
atcaccctgacgcacattgaatcccgtccatcgcaggcgaacaaagaccactatgagttc
ttcatcagtgtggattccacctcctcccaggccctggatgaggtcatcaacagcctgcgt
acacaaatcagcggccacgtgcatgagctctcacgcaacaaacagaaggacacagtgcca
tggttccctaatgacatcccagacctggaccgctttgccaaccagatcctcagctatggc
tccgagctggatgcagaccacccaggcttcacagatccagtgtacagagcccgcaggaag
gagtttgctgacattgcctacaactacagacatggtcaaactatccccaggatggagtac
acagaggatgaaaaggccacatggggcacagtgttcaaggaactcaagagtctgtaccca
actcacgcctgccgtgagcacaaccgggtcttccccctgctggagaaatactgtggctac
aggccggacaacatcccacagctggaagacgtgtctcgcttcctgcagtcatgcacaggt
ttccggcttcgcccggtggctggcctgctctcgtctcgggacttcctggcgggacttgcc
ttccgtgtcttccattccacccagtacatccgtcacagctccaagcccacgtacacacct
gagccggacatctgccatgagctcctggggcatgttccgttgtttgctgacccaagtttt
gcccagttctcacaggaaattggacttgccacccttggtgcccctgatgagtacgttgag
aaactagctactgtctactggttcactgtggagtttggcctatgtaagcagggctcagag
atcaaagcttatggtgctggcttgctttcatcatttggagagctgcagtactgcttgaca
gacaagcccaaactccagccctttgatcctgacaagaccagcctccagaaatacccgatc
acagagtaccagcctgtttactttgtggctgagagctttgaagatgcccaggagaaagtg
aggaaatttgcagccactatcccaagacctttcaccgtgcgttacaacccctacacccag
agtattgatgtgctggacaacacccagcagctcaggagcttggctgacagtatcagtaat
gaactggggaaactgtgtgaagccctgcggaaactgcagtaa

DBGET integrated database retrieval system