KEGG   Monopterus albus (swamp eel): 109967924Help
Entry
109967924         CDS       T05607                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13-like
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04270  Vascular smooth muscle contraction
malb04371  Apelin signaling pathway
malb04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109967924
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109967924
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109967924
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109967924
   04031 GTP-binding proteins [BR:malb04031]
    109967924
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109967924
  Exosomal proteins of colorectal cancer cells
   109967924
GTP-binding proteins [BR:malb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    109967924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA MMR_HSR1 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 109967924
NCBI-ProteinID: XP_020469492
Position
Unknown
AA seq 377 aa AA seqDB search
MADFLPTRSVLKVCLPVCLLNSGEVEQLRKSKEIDRCISREKPYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREDFRGTIYSNVIKGIRVLVDAREKLHIPWGEPDNQQHGD
SLMAFDTRSAKMAGGQLETSNFMQYLPAIRALWQDSGIQNAYDRRREFQLGESVKYFLDN
LDKLGQPNYLPSQQDILLARKPTKGIHEYDFEIKNVPFKMVDVGGQRSERRRWFECFDSV
TSILFLVSSSEYDQVLMEDRQTNRLRESLNIFETIVNNRVFVNVSIILFLNKTDLLEEKV
KSVPLKDYFSDYTGPEHSLPDIQAFMVECFRAKRRDATQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcctgccgaccaggtccgtgttaaaagtttgtctacccgtctgcctgctc
aacagcggcgaagtagaacagctccgaaagtccaaggagatcgacagatgtatctctcgg
gagaaaccgtacgtgaaacggctggtaaagatcctgctgctaggcgctggcgagagcggc
aaatcgactttcctcaaacaaatgcggatcatccacgggcaggacttcgaccagcgagcc
cgagaggacttcagaggcacgatttacagcaacgttatcaaaggtatacgtgtgttggtg
gatgctcgggagaagctgcacatcccatggggtgaaccggacaaccagcagcatggggac
agcctgatggcttttgacacccggtcggctaagatggctggtgggcagctggaaacgtct
aactttatgcagtacctgcccgccataagagctctgtggcaggactcgggtatacagaac
gcttacgatcgtcgcagggagtttcagctgggtgagtcggtgaagtatttcttggataat
ctggataagcttggccagccgaactatctccctagtcagcaggacatcctgctggcccgc
aagcccaccaaaggcatccacgagtatgactttgagatcaagaatgttcccttcaagatg
gtggacgtgggaggtcagcggtcagagcgacgacgctggttcgagtgtttcgactcggtc
acctccatcctcttcctcgtctcctcttctgaatatgaccaggtgctgatggaggacagg
caaactaataggctgcgtgaatcactcaacatcttcgagaccattgtcaacaaccgcgtg
tttgtcaacgtttccataatcctcttcctcaacaagacagacctgctggaggagaaggtg
aagagcgttccgctcaaggactacttttctgactacaccgggccggagcacagcctgccg
gacatccaggcgttcatggtggagtgcttcagggccaagagacgcgacgccactcagaag
cccctgtaccaccacttcaccacggccatcaacacggagaacatcaggctggtgttccgg
gacgtcaaggacaccatcctccacgacaacctcaaacagctcatgctccaatga

DBGET integrated database retrieval system