KEGG   Monopterus albus (swamp eel): 109969571Help
Entry
109969571         CDS       T05607                                 

Definition
(RefSeq) guanylate cyclase 2G-like
  KO
K22600  guanylate cyclase 2G [EC:4.6.1.2]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00230  Purine metabolism
malb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109969571
Enzymes [BR:malb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     109969571
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr ANF_receptor Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 109969571
NCBI-ProteinID: XP_020472207
Position
Unknown
AA seq 1068 aa AA seqDB search
MSRIVCFSGMSHTLLLHVLLVLPAAVLSNISTNGSQPLKLRVGFQAPWNMSFPFSALRLG
SAIQIAVEKVTGLIASTWNIPMFGFAGQSSKMDNTDIYDSYIKIVPPLKRSSEVLEKTLE
FFGWSHIAMIGGGLESNTWNKVDALWKTVENPLRTKFKLTAAIKFDTTNPELLHQNVKYI
STVARVIVVLTNSEDSMALLLEAEKQGMMNGDYIFFLLQHFEDNLWKYAQNKRINQAAVR
AFDMAFIISQKTDDSFEYYDFFEQVFQRLRGHPFWSNLTSDREISPYSAYLHDAVLLYAM
GLKEVLKDGKDPQDGRQLLQTLKNKNNFRFNGASGLVHFDEKGERNLDYSIYDLQHSGDV
TKFVPVLHFESRTKNVRPTSMFASVVWPKGRPPNDNPECGFNNELCEWIINDIALLGLLV
ALPVVGMLALLSIGVLILQRFRLQTRLDDSCWWLINYSDITIIKEPSGTQGFSLSTTRSQ
SGSSGSQSNFSSNSYGLRDKNGKEHIYSTIGLYQGNQVAIKYIKNPICCNFQKPSIITEF
NVMKEMKHENLVQFFGACVEPPNVCLVIQYCRKGSLKDVLKASDVELDGMFKLSFAYDIV
NGMEFIHKSSLKFHGNLKPSTCLVDSRLQIKLSGFGLWEFKHGGRIGISLENPSYEEMYW
TAPELLRQVSLTVNGTPKGDIYSFAIIMWELMYNSKSGPYRDINLEPKEIIMQLRTPFQG
EPLRPVLYEQLCDENINLLLRACWSENPDHRPPAGSIRRQLRDISPDSHANILDNMVDKL
EKYANHLEEVVEDRTNQLMAEKARADKLLSSMLPRNIADQLMAGMSVEPRSYDLVTVFFS
DIVGFTSMCALSSAMEVVTFLNDLYSLFDDIIKLYDVYKVETIGDAYMVASGLPITNGNK
HALEIATMALHFLRAIKVFRIRHMPTERLAIRIGVHSGPVVAGVVGITMPRYCLFGDTVN
MASRMESNGLPLKIHISQYTADILIQAGSFELEERGEIELKGKGSHKTYWLLNKSGFNPP
LIAHSSPTADSLKQQTEKPGVAKAMDKKAQKTLTKAQMIDTTSVHIKN
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggatcgtatgcttttctgggatgagccacacactgctgctccacgtcctactt
gtgctacccgctgctgttctcagtaacatcagcacaaatgggtctcagcctctcaagctg
cgtgtcggcttccaggctccctggaacatgtccttccccttcagcgccctgcggctgggc
tcggctatacagattgctgtggagaaggtcactggtctcatcgcatcaacatggaacatc
cccatgtttggctttgcgggacagtcctccaaaatggacaacactgatatctatgactcc
tacattaaaattgtgccacctcttaaaagaagctcagaggtcctggagaagacgctggag
ttcttcgggtggagtcacatagcgatgatcggagggggattagagtcaaacacatggaac
aaagttgatgctttgtggaaaactgttgagaatccactaagaaccaaattcaaactgact
gcagccatcaagtttgacaccaccaaccctgaactccttcatcaaaatgttaagtacatc
tcaacagttgccagagtgattgtggtgctaacaaacagcgaggactctatggctttgttg
ctggaggctgagaaacagggtatgatgaacggtgattacatattcttcctgctgcagcat
tttgaggataacttgtggaaatatgcccagaacaaaaggataaaccaagctgccgtaaga
gcttttgacatggccttcatcatcagtcagaaaaccgatgacagctttgagtactatgac
ttctttgagcaggttttccagaggctaagaggacaccccttttggagcaatctgacatct
gacagagagatcagcccctactctgcctacctgcatgacgcagtgctgctgtatgcaatg
ggccttaaggaggtcctcaaggacggcaaagaccctcaggatggacgacagctgctacag
acactgaaaaataaaaacaactttcgatttaatggtgcttctggacttgtccactttgac
gagaagggcgagagaaatttagactactccatttacgacctgcagcactcaggagatgtt
accaagtttgtgcccgtcctgcattttgagagtcgcaccaaaaatgtccggccgacatct
atgtttgcttctgtggtttggcccaaaggacgacctcctaatgataacccagaatgcgga
ttcaacaacgaactctgtgaatggataattaatgacatcgccctgctgggtctgttggtg
gccctccccgtggtcggcatgctggcacttctgtccatcggggtcctcattctgcagagg
tttcgactccagacaaggctcgatgactcctgctggtggctcatcaactacagcgacatc
accatcatcaaggagccctcgggaactcagggtttttctctcagcaccacaagaagtcag
agtgggagcagtgggtctcagtccaacttctccagcaacagctatggcctgagggacaag
aacgggaaagaacatatctacagcacaataggtctttaccagggaaatcaagtggccatc
aagtacatcaagaatcccatctgctgtaatttccagaagccttcaattatcacagagttc
aatgtgatgaaagagatgaaacatgagaacttggtgcagttttttggtgcttgcgttgag
ccaccgaacgtctgcttggtcatccagtactgcaggaaagggagcctgaaggatgtttta
aaggcatcagatgttgagctggatgggatgttcaagctgtcctttgcatatgatatcgtc
aatggaatggagttcatccacaaaagtagcctgaagtttcatggcaacctgaagcccagc
acatgtctggtggacagccgactccagatcaaactctcaggctttggactgtgggagttt
aaacacgggggcagaatcgggatctcactggaaaaccccagttatgaagagatgtactgg
acagcccctgagctgctgagacaagtcagtctcacggtcaacgggacacctaaaggtgac
atctacagctttgccatcatcatgtgggagctaatgtacaactctaagtctggcccatac
cgcgacatcaacctggagcccaaagagattattatgcagttgcggacacctttccaaggg
gagcccttgcgaccagtgctgtatgagcagctgtgtgatgaaaacatcaacttactgctg
agggcctgctggagtgaaaaccctgaccaccgccctccagctgggtcaatacggagacag
ctgagggacatcagcccagacagtcatgcaaatatactggataatatggtggataagttg
gagaaatatgcaaatcacttggaggaggtggtggaggacaggaccaatcagcttatggca
gagaaggcccgtgcagacaagcttctctccagcatgttacccaggaacatcgcagatcag
ctgatggcagggatgtcagtggagccgcggagctacgacctggtgaccgtcttcttctct
gacattgtgggcttcacctccatgtgcgctctcagctctgcaatggaggtggtcacattc
ctgaacgacctgtacagcctcttcgatgacatcatcaagctgtatgatgtctacaaggtg
gaaacaattggtgatgcttacatggtagccagtggtctacccatcaccaacggcaataag
catgctttggagatagcaacaatggctctgcatttcctgagagcaatcaaggtcttcaga
attcgacacatgcctacagagaggcttgccattcgcattggggtacactcgggtccagtg
gttgctggagtcgtcggcatcactatgcctcgctactgtctgtttggagacacagtgaac
atggcatcccgtatggaaagcaacggcttacccctgaagatccacatatctcagtacact
gcagacattcttatccaggctggatcatttgagttggaggaaagaggagaaatcgaactt
aagggtaaagggagtcataagacctactggctgctcaacaaaagtggatttaaccctcct
cttattgctcacagctctccgacagctgacagtctcaaacaacaaacagagaaacctgga
gtggcaaaggccatggacaaaaaggcccagaaaaccctgaccaaagctcaaatgatagac
accaccagtgtccacataaagaactag

DBGET integrated database retrieval system