KEGG   Monopterus albus (swamp eel): 109969767
Entry
109969767         CDS       T05607                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00230  Purine metabolism
malb00240  Pyrimidine metabolism
malb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109969767 (dck)
   00240 Pyrimidine metabolism
    109969767 (dck)
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     109969767 (dck)
SSDB
Motif
Pfam: dNK AAA_18 YusW Thymidylate_kin
Other DBs
NCBI-GeneID: 109969767
NCBI-ProteinID: XP_020472560
Position
Unknown
AA seq 272 aa
MPFTPKRPCPDSMNDSMEKRIKRVSVEGNIAAGKSTFVRLLELESADWEVVPEPIARWCN
VHANSGDFEELTTSQKSGGNVLQMMYEKPERWAYTFQSYACISRVRAQIKSANGKLREAE
HPVQFFERSIYSDRYIFAANLYESECLNETEWSVYQDCHSWLHSQFGKHIELDGIIYLRA
TPEKCLERLYLRGREEEQDIPLEYLEKLHFKHESWLQHRTMAMEYEYLSDVPVLTIDVNE
DFKRNDLKRDDMVKKVKEFLSTLSPDGKQMTP
NT seq 819 nt   +upstreamnt  +downstreamnt
atgccttttactccaaagaggccctgtcccgattcaatgaacgactcgatggagaagagg
ataaagcgggtttcagtcgagggaaacattgcggcgggcaagtccacctttgtgcgcctt
ttggagctggagagcgcggactgggaggtagtaccagagcccatcgccaggtggtgcaat
gtccacgcaaacagcggtgactttgaggagctgaccacatctcagaagagcggggggaat
gtgttgcagatgatgtatgagaagccagagaggtgggcctacaccttccagagctacgcc
tgcatcagccgggtgcgtgctcagatcaagtcagccaatgggaaactgcgagaggctgag
catcctgtgcagttctttgagcggtccatctacagcgacaggtacatctttgccgccaac
ctctatgagagcgagtgcctgaatgagactgaatggtctgtgtaccaggactgtcacagc
tggctgcacagccagtttggcaagcacatagagctggacgggatcatctacctccgagcg
acaccggagaaatgtttagaaagattgtacctgagaggtagagaagaagaacaagacatt
cctctggagtatctggagaagctccacttcaaacatgagagctggctgcagcacaggacc
atggccatggagtacgagtatctcagtgacgttccagtcttgactatagatgtgaatgaa
gacttcaagaggaacgatctgaagagagatgacatggttaagaaggtgaaagagttcttg
agcacattgtctcctgatggaaaacagatgacgccataa

DBGET integrated database retrieval system