KEGG   Monopterus albus (swamp eel): 109969798
Entry
109969798         CDS       T05607                                 

Gene name
rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    109969798 (rdh5)
Enzymes [BR:malb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     109969798 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 109969798
NCBI-ProteinID: XP_020472659
Position
Unknown
AA seq 332 aa
MDMQFAYHLLWENVWLYITGTFVVLWIIVWLYRDSLEIDKVTDKYVFVTGCDTGFGNLLC
KKLDRKGFHVLAGCFTEKGADDLKRVTGPHLKTVLLDVTSQHSIQKAMEWTKKEVGDMGL
WGIVNNAGRALPMGPSEWMKVEDFHSIMKVNVDGVIAMTMTFLPLIKKARGRIVNVASVL
GRVAANGGGYCISKFAVECFSDCLRRDISYFGIKVCIIEPGFFKTALTNLEAIEREMNRL
WSQLSPEVQASYGEKYLEKFLKIQHLAMKFICDPDITKVTNCMEHALTAAYPRTRYSAGW
DAKLVWIPLSYMPSCVVDIGLKLLLPRPLKSI
NT seq 999 nt   +upstreamnt  +downstreamnt
atggatatgcagtttgcctaccaccttttatgggaaaatgtttggttgtacatcactggt
acctttgtggtgttgtggattattgtgtggctatacagagacagcctggagattgataaa
gtcactgacaagtatgtctttgtgactggctgtgacactggattcggaaacctgctgtgc
aagaagctcgatcgcaaaggtttccatgtgctggctggctgcttcacagaaaaaggagct
gatgatttgaaaagagtgacaggccctcatttgaagacggtcctgttggatgtgaccagt
cagcacagcatccagaaagccatggagtggaccaagaaggaggttggcgatatgggactt
tggggtattgtgaacaatgcgggacgcgcattacccatgggtccttcagagtggatgaaa
gtggaggatttccacagcataatgaaagtcaacgtggatggagtgattgccatgacaatg
accttcctgcctctcatcaaaaaggctcgtggtcgcattgtaaatgttgcttcagtgctg
ggaagagtggctgcaaatggcggtggatactgcatctccaagtttgcagtggagtgtttc
tccgactgcctcaggagagacataagctactttggaatcaaagtgtgcatcattgagccg
gggtttttcaagactgcattgacaaacctcgaggccattgaaagggaaatgaaccgcctg
tggagccagctcagccctgaggtacaagccagctatggagaaaagtaccttgagaagttc
ttgaagattcagcatctggccatgaagtttatctgcgatcctgacattaccaaggtgacc
aactgcatggagcacgctctgactgctgcatacccacgcaccagatacagcgccggctgg
gacgccaagcttgtctggatccccctctcttacatgccttcctgtgtggttgatattggg
cttaagctgttgctgccacgtcctttaaagagcatttaa

DBGET integrated database retrieval system