KEGG   Monopterus albus (swamp eel): 109969812Help
Entry
109969812         CDS       T05607                                 

Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00510  N-Glycan biosynthesis
malb01100  Metabolic pathways
Module
malb_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    109969812
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:malb01003]
    109969812
Enzymes [BR:malb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     109969812
Glycosyltransferases [BR:malb01003]
 Glycan extension
  N-Glycan
   109969812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 109969812
NCBI-ProteinID: XP_020472642
Position
Unknown
AA seq 230 aa AA seqDB search
DSYGHYREPFITQTKHHWWWKLHFVWERVHVMQGYSGFVVFLEEDNYIFPDFFHFYKLMI
KFRKNTCPDCDMLALGNHNALTDFPRLSNKVLTTGWLSTKHNIGMAMPREVYYKLMGCSN
DFCTYDDYNWDWTLQHLSGTCISKPLKVLVTQGSRVLHTGDCGLHQQKNCRPEWAAQKVE
EGLQMVKDNLFPQSLVLSGAEAVEHKVHVKNGGWGDVRDHVLCNNYAKRL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gactcctatgggcactacagggaacccttcatcactcaaaccaaacaccactggtggtgg
aaattgcactttgtgtgggagagagtgcatgtcatgcagggctacagtggctttgtagtc
tttctggaggaggacaactacatctttcctgacttttttcatttctataaattaatgata
aagttcaggaagaacacctgccctgactgtgacatgctggctttgggtaaccacaacgcc
ctgactgattttcccaggctgtccaataaggtgttgaccactggttggctgtccactaaa
cacaacataggcatggccatgccaagggaggtatactacaagctgatgggctgcagcaac
gatttctgtacctatgacgattacaactgggactggactctgcagcacctctcaggaacc
tgcatatcaaagccgctcaaagtgctggtaacacagggctccagggttctccacacagga
gactgtggtcttcaccagcagaagaactgcaggccagaatgggctgcacagaaggtagag
gaggggcttcaaatggtgaaggacaacctctttcctcagtctcttgtcttaagtggtgca
gaagcagtggagcacaaggtacacgtgaagaacggaggctggggagatgttcgagaccat
gttctatgcaacaactatgccaaacgtctttga

DBGET integrated database retrieval system