KEGG   Monopterus albus (swamp eel): 109970433Help
Entry
109970433         CDS       T05607                                 

Gene name
amt
Definition
(RefSeq) aminomethyltransferase, mitochondrial
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00260  Glycine, serine and threonine metabolism
malb00630  Glyoxylate and dicarboxylate metabolism
malb00670  One carbon pool by folate
malb01100  Metabolic pathways
malb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    109970433 (amt)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109970433 (amt)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    109970433 (amt)
Enzymes [BR:malb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     109970433 (amt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C PBP_like
Motif
Other DBs
NCBI-GeneID: 109970433
NCBI-ProteinID: XP_020473644
Position
Unknown
AA seq 417 aa AA seqDB search
MWARLLVGLGGSGLGFRAFRDGLLRVAGAGCAGRRQQQRQASAAEPSLKKTPLFDFHREN
GGKMVEFAGWSMPVQYKDSHIASHVHTREHCSIFDVSHMLQTKVHGKDRVKFMESLVVAD
IAELKDNQGILSLFTNEKGGIIDDLIVTKTDCGYLYIVSNAGCADKDSAHMKARLAEFRA
AGLDVDLEFLDEALIAVQGPTMSHVLQEGLKEDLGKLSFMTSTLATVFGVPGCRVTRCGY
TGEDGVEISVPQSRVVELTEKLMANREVKLAGLGARDSLRLEAGLCLYGSDIDETTTPVE
AALVWTIGKRRRQTKDFPGADIVIPQIKSKTARKRVGLVSTGPPVRQHTPVLSPDGKVIG
KVTSGCPSPCLKKNIAMAYVDAAFAKNETALQVEVRKKAVPATVSKMPFVPTNYFYG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtgggctcggctactggttgggcttgggggctcggggctcgggttccgggctttccga
gacggtttactgcgggtcgctggagctggatgtgcggggaggaggcagcaacagaggcag
gcttcagccgcggagccttctttgaagaagactccactgtttgacttccacagagagaat
ggtgggaaaatggttgagtttgcgggctggagtatgcctgtccagtacaaagacagtcac
atcgcatcacacgtgcacaccagggagcactgctccatctttgatgtcagccacatgctg
cagaccaaagtccatggcaaagatagggtgaagttcatggagtctctggtggttgcagat
attgcagaactgaaggacaaccagggtatattgtccctcttcaccaatgagaaaggtggg
attattgatgaccttatagtgacaaagacagactgtggctacctgtacattgtctccaat
gccggctgtgctgacaaggactcggctcatatgaaggccaggctggcagagttcagagct
gcaggtcttgatgtggatctggagtttcttgatgaagcgctgattgctgtgcaaggacca
accatgtcacatgtgctccaggaggggctgaaggaagaccttggtaagctaagcttcatg
acctccaccctggctaccgtgtttggtgtccctggctgcagggtcacacgctgtggatac
actggagaggatggggtggagatctctgtccctcagtccagagtggtggagctgacagag
aagctgatggctaacagagaggtgaaactggccggcctgggcgccagagacagtttgagg
cttgaggcgggactttgtctctatggcagtgacatagatgagaccaccacacctgtggaa
gctgcccttgtctggaccatcggaaagcgacggcgccagaccaaggatttccctggcgct
gacatcgtcatacctcagatcaaatccaagacagccaggaagagagtcggcctggtgtcc
actggcccccctgtcaggcaacacacgcccgttctcagccctgatggaaaggtcataggc
aaggtgaccagtggctgcccctctccgtgtctgaaaaagaacattgctatggcttatgtg
gatgcggcattcgctaagaatgaaactgctctccaggttgaggtcaggaagaaagcagtg
cctgccacagtcagcaagatgccctttgtccccaccaactatttttatggataa

DBGET integrated database retrieval system