KEGG   Monopterus albus (swamp eel): 109971419
Entry
109971419         CDS       T05607                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53-like
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109971419
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    109971419
SSDB
Motif
Pfam: DUF5040 Ank_5
Other DBs
NCBI-GeneID: 109971419
NCBI-ProteinID: XP_020475316
Position
Unknown
AA seq 239 aa
MLVQAGADVLARDSMGHTPLDLAHIWCRRKVARYLKSCMWKAEKNKEMEERKLVRTLYSD
LVDMAKVNHLHKRTLINERMAEWANKKGFPLLMDFTPRVQVSQYHTSCLSSGQDSKITSS
KPPTASRPWTIYTGLEPEKPFTEPDLRDSVTVWRDHSSRQPQYTTKWDSTPRAAPDLPLD
TLERVLFPRAFPSRIVSPWDFKPQDIITVQHRGYGAGRSTSPWTEVAMHLAEVLEPGHY
NT seq 720 nt   +upstreamnt  +downstreamnt
atgctcgtgcaggccggggcagatgtgctggcccgggatagcatgggacatacacctctg
gatttggcccacatctggtgccgcaggaaggtagcaagatatctgaaaagctgcatgtgg
aaggcagagaagaacaaagaaatggaggagaggaagctagttcgcactttatacagtgat
cttgtggacatggccaaagtgaatcatctccacaaaaggacactgataaatgagagaatg
gcagagtgggccaacaagaaaggttttcccctcctaatggatttcacccccagagtccag
gtgagccagtaccacacctcatgcctctcatcgggtcaggacagcaagatcacttcctca
aagccacctacagcctccaggccttggaccatctatacgggccttgagccagagaaaccc
ttcacagagccagaccttcgggacagtgtcacagtatggagggaccatagcagcaggcag
cctcagtatactacgaagtgggacagtacacctcgtgctgcccctgatctgcctctggat
acccttgagagggtgcttttccccagagccttcccatctaggattgtctctccttgggac
ttcaagccacaggacatcataacagtccagcatcgaggatatggggcggggcggagcacc
tccccctggacagaggtggccatgcatctggctgaggtgctggagcccggacactactga

DBGET integrated database retrieval system