KEGG   Monopterus albus (swamp eel): 109971527Help
Entry
109971527         CDS       T05607                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04260  Cardiac muscle contraction
malb04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109971527
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109971527
   04261 Adrenergic signaling in cardiomyocytes
    109971527
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:malb04040]
    109971527
Ion channels [BR:malb04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109971527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 Claudin_3 DHHC
Motif
Other DBs
NCBI-GeneID: 109971527
NCBI-ProteinID: XP_020475492
Position
Unknown
AA seq 276 aa AA seqDB search
MSACSRKALTLLSSVFAISGLGLLGVSVSTDYWLYLEEGVIMPLNQSTDIKTSLHSGLWR
VCFLAGDESGRCFTIEYIMPMNVQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFVLNNI
GHVRPHRTILAFVSGIFFILSGLALVVGLVLYISSINDEMLNRTKSSEAYFAYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEEIYQPHRPSFYRPRLSNCSDHSGQFLHPEAWSR
GRSPSDISSDASLQMSTSYPALLKCPEYDQVSSSPC
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttgcagcagaaaggctctgacattgttgagcagtgtctttgcaatcagtggc
cttgggctcctgggagtttcagtcagcaccgactactggttgtacctggaggagggagtg
attatgcctctgaaccagagcactgacatcaagacctcactgcattctggactgtggaga
gtctgcttcctggctggtgacgagtctggtcgctgcttcaccatcgagtacatcatgcca
atgaacgtccagctgacgtcagagtccacagtaaacgtgctcaagatgatccgctcagcc
actccgttccctctggtcagcctcttcttcatgttcatcggctttgtcctcaacaacatc
gggcacgttcggccacaccgcactatcctggcgttcgtctctggaatcttcttcatcctc
tcaggtctagctttggtggtgggactggtgctgtacatctccagtataaatgatgaaatg
ttgaacaggactaaaagcagcgaggcctattttgcatacaagtacggctggtccttcgcc
ttcgctgccatctccttcctactcaccgagagtgcgggcgtcatgtccgtctacctgttc
atgaagcgctacacagcagaagagatctaccagcctcatcgccccagtttctaccgtcct
cgtctcagcaactgctctgaccactcgggccagttcctccacccagaggcctggtcgcga
gggcggagtccctctgacatctcgagtgacgcttcgctccagatgagcactagctaccct
gctctcctcaaatgccccgaatacgatcaggtctcctcgtcaccctgctga

DBGET integrated database retrieval system