KEGG   Monopterus albus (swamp eel): 109971588Help
Entry
109971588         CDS       T05607                                 

Definition
(RefSeq) heat shock 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb03040  Spliceosome
malb04010  MAPK signaling pathway
malb04141  Protein processing in endoplasmic reticulum
malb04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109971588
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109971588
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109971588
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109971588
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109971588
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:malb03041]
    109971588
   03009 Ribosome biogenesis [BR:malb03009]
    109971588
   03110 Chaperones and folding catalysts [BR:malb03110]
    109971588
   04131 Membrane trafficking [BR:malb04131]
    109971588
   03051 Proteasome [BR:malb03051]
    109971588
   03029 Mitochondrial biogenesis [BR:malb03029]
    109971588
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109971588
Protein phosphatases and associated proteins [BR:malb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109971588
Spliceosome [BR:malb03041]
 Complex B
  Other components
   Prp19 complex
    109971588
 Complex C
   Prp19-CDC5 complex
    109971588
Ribosome biogenesis [BR:malb03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109971588
Chaperones and folding catalysts [BR:malb03110]
 Heat shock proteins
  HSP70 / DNAK
   109971588
Membrane trafficking [BR:malb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109971588
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109971588
Proteasome [BR:malb03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109971588
Mitochondrial biogenesis [BR:malb03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109971588
Exosome [BR:malb04147]
 Exosomal proteins
  Proteins found in most exosomes
   109971588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464 Zincin_2 Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 109971588
NCBI-ProteinID: XP_020475595
Position
Unknown
AA seq 638 aa AA seqDB search
MSSAKGISIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPTNTVFDAKRLIGRKFSDPVVQADMKLWPFKVINDNGKPKVQVEYKGEIKAFYPEE
ISSMVLVKMKEVAEAYLGQKLSNAVITVPAYFNDSQRQATKDAGVISGLNVLRIINEPTA
AAIAYGLDKGKRGERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMV
KHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSIT
RARFEELNSELFRGTLEPVEKALQDAKLDKSKIHEIVLVGGSTRIPKIQKLLQDFFNGRE
LNKSINPDEAVAYGAAVQAAILMGDTSKNVQDLLLLDVAPLSLGIETAGGVMTPLIKRNT
TIPTKQTQIFSTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQVEVTF
DIDANGILNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDAEKYKSEDDLQREKIAA
KNSLESYAYHMKSSVEDETMKGKISEEDKKTVIDKCNQTISWLESNQLAETDEYEHQQKE
LESVCKPIITKLYQGAAAGGCDSQAKGSSQGPTIEEVD
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagctaaaggaatatcgattggtattgatctgggcaccacctattcatgtgtt
ggggttttccagcatggcaaagtagagatcattgccaatgaccagggcaacaggaccact
cccagctatgtggcctttactgacactgagaggctcattggagatgctgccaagaaccag
gttgccatgaaccccaccaacacagtctttgatgccaagcgtcttattgggagaaagttt
agtgaccccgttgtccaggctgatatgaaactctggcctttcaaggtgattaacgataat
ggaaagcccaaagtccaggtggagtacaaaggtgagatcaaggccttctatccagaagaa
atctcatctatggttctagtaaaaatgaaggaggtagctgaggcctatctgggacagaag
ctgtcaaatgctgtaatcacagtgccagcttatttcaacgactctcagaggcaagccacc
aaggatgcaggggtgatctctggactgaatgttctgagaataatcaacgagcccacagca
gcagccatcgcctatggccttgataaaggtaaaagaggagagcgcaatgtgctcatcttt
gaccttggtggaggcacctttgatgtgtccatcctaaccattgaagatggcatctttgag
gtgaaagccactgcaggagacacacaccttggcggggaggactttgacaacaggatggtt
aaacactttgtagaggaattcaaaagaaagcacaagaaggacatcagccagaataagaga
gcagtgaggagactgcgtacagcttgtgagagagcaaagaggaccttatcctccagcacc
caggctagccttgagattgactctctgtttgagggcattgacttctacacctccatcaca
agggcacgttttgaggagctcaactcagagctcttcaggggaacactggagccagttgag
aaggccctgcaagatgcaaagctggataagtccaagatccacgaaattgtcctggttggc
ggctccacaagaattcctaaaattcaaaagctcttgcaagatttctttaatggtagagaa
ttgaacaagagcatcaacccagatgaagctgtggcttatggtgcagcagtccaggctgct
atcctcatgggtgacacttccaagaacgtacaagatctactgctgctggacgtggctccc
ctgtctctgggcattgagactgctggtggagttatgacaccactaatcaaacgcaatacc
accatacccaccaagcagacccagatcttctccacatactcagataatcagccaggtgtg
ctgattcaggtgtttgagggcgagagagccatgaccaaggacaacaacctgctgggcaag
tttgagctcacaggtatccctcctgcacctcgaggtgtaccacaggtggaggtcactttt
gacatcgatgccaatggcattctgaatgtgtctgccgtagacaaaagcaccggcaaagaa
aacaaaatcaccataaccaatgacaagggccgcctcagcaaagaggagattgagcggatg
gtacaggatgctgaaaagtacaagtctgaggacgacctgcagagggagaagattgcagct
aagaactcactggagtcctatgcctaccacatgaagagcagtgtcgaggatgagactatg
aaaggaaagattagcgaggaggataagaaaacggtcattgacaagtgcaaccagacaatc
tcctggctggagagcaaccagctggctgagacagatgagtatgagcatcagcagaaagaa
ctagagagtgtgtgcaagccaattattacaaaactgtaccagggagcagcagcaggaggc
tgcgacagccaggccaaaggcagctcccagggccccactattgaggaagtggactaa

DBGET integrated database retrieval system