KEGG   Monopterus albus (swamp eel): 109972025Help
Entry
109972025         CDS       T05607                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb03040  Spliceosome
malb04010  MAPK signaling pathway
malb04141  Protein processing in endoplasmic reticulum
malb04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109972025
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109972025
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109972025
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109972025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109972025
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:malb03041]
    109972025
   03009 Ribosome biogenesis [BR:malb03009]
    109972025
   03110 Chaperones and folding catalysts [BR:malb03110]
    109972025
   04131 Membrane trafficking [BR:malb04131]
    109972025
   03051 Proteasome [BR:malb03051]
    109972025
   03029 Mitochondrial biogenesis [BR:malb03029]
    109972025
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109972025
Protein phosphatases and associated proteins [BR:malb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109972025
Spliceosome [BR:malb03041]
 Complex B
  Other components
   Prp19 complex
    109972025
 Complex C
   Prp19-CDC5 complex
    109972025
Ribosome biogenesis [BR:malb03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109972025
Chaperones and folding catalysts [BR:malb03110]
 Heat shock proteins
  HSP70 / DNAK
   109972025
Membrane trafficking [BR:malb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109972025
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109972025
Proteasome [BR:malb03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109972025
Mitochondrial biogenesis [BR:malb03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109972025
Exosome [BR:malb04147]
 Exosomal proteins
  Proteins found in most exosomes
   109972025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl BcrAD_BadFG FGGY_C DDR Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 109972025
NCBI-ProteinID: XP_020476276
Position
Unknown
AA seq 642 aa AA seqDB search
MSKGAAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFEDPVVQSDMKHWPFTIISDSGRPKVEVEYKGETKTFYPEEIS
SMVLTKMKEIAEAYLGKSVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA
IAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRA
RFEELNADLFRGTLDPVEKSLRDAKMDKGQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVAAKN
GLESYAFNMKSTVEDEKLAGKISDDDKQKILDKCNEVISWLDKNQTAEKDEYEHQQQELE
KVCNPIITKLYQNAGGMPGGFPGAGGAPTGGGSSGPTIEEVD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaggggcagcagttggcattgatcttgggaccacctactcctgtgttggtgtt
ttccagcatggcaaagttgaaatcattgccaatgaccagggcaacaggaccacacccagc
tatgtggccttcacggatagtgagcggctgatcggagatgcagccaagaatcaggttgcc
atgaaccccaccaacacagtcttcgatgctaaacgtttgattggcagaagatttgaggat
ccagtagttcagtctgacatgaaacactggccattcaccataatcagtgatagtggacgc
cccaaagtggaggtggaatacaaaggtgaaaccaaaaccttctacccagaggaaatctct
tccatggtgctgacaaagatgaaggagattgctgaagcctacctcgggaagtctgtgtca
aatgctgttatcacagttcctgcatattttaatgactctcaacgtcaagcaaccaaggac
gccggaactatctctggtctaaatgtgttgagaataattaatgagcccactgcagcagct
attgcttatggcttggacaagaaggttgggtctgagaggaatgttctcatctttgatctt
gggggtggcaccttcgacgtgtccatcttgaccatcgaggatggcatctttgaagtcaag
tctactgctggagatactcatcttggtggggaagatttcgacaaccgcatggtgaaccac
ttcatcgcagagttcaagcgcaagtacaagaaggacatcagcgacaacaagagagctgtc
cgtcgtctgcgcaccgcttgtgagagggcaaagcgcaccctgtcttccagcacccaggcc
agcattgaaattgactctctgtatgagggagttgacttctacacctccatcaccagggct
cgctttgaggagctcaacgctgacctcttccgtggcaccctggaccctgtggagaagtct
ctccgtgacgccaagatggataaagggcagattcatgacattgtgttggttggcggctcc
acccgtatccccaagatccagaaactgctgcaggatttcttcaatggaaaggagctcaac
aagagtatcaatccagatgaagctgtggcttatggagctgctgtccaggctgccatcctg
tctggtgacaaatctgaaaatgtgcaggacttgctgcttctggatgtcactcctctgtcc
ctgggtattgagaccgctggtggtgtcatgacagtcttgatcaaacgtaacaccaccatt
cctaccaagcagactcagaccttcaccacctactctgacaaccagcctggtgtgctcatc
caggtttatgagggcgagcgcgctatgacaaaggacaacaacctgctgggcaagtttgag
ctcaccggcatccctcctgctcctcgtggtgttcctcagattgaggtgacctttgatatc
gatgccaacggcatcatgaacgtctctgctgtcgacaagagcaccggcaaggagaacaag
atcaccatcaccaatgacaagggtcgtctcagcaaggaggacattgagcgcatggttcag
gaagccgagaagtacaaggcagaggacgacgtccaacgtgacaaggtggccgctaagaac
ggcctggagtcgtatgctttcaacatgaagtcgactgtggaggatgagaagcttgctggc
aagatcagtgatgatgacaagcagaagatcttggacaagtgcaatgaggtcatcagctgg
cttgacaagaaccagactgcagagaaggatgagtatgagcatcaacaacaggagctggag
aaggtatgcaaccccatcatcaccaagctgtaccagaacgctggtggcatgccaggtggc
ttccctggagcaggtggtgctcctactggtggaggatcctccggaccaaccatcgaggaa
gtcgactga

DBGET integrated database retrieval system