KEGG   Monopterus albus (swamp eel): 109973254Help
Entry
109973254         CDS       T05607                                 

Gene name
iws1
Definition
(RefSeq) protein IWS1 homolog
  KO
K17498  transcription factor SPN1
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:malb03021]
    109973254 (iws1)
Transcription machinery [BR:malb03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     109973254 (iws1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26 DUF4196
Motif
Other DBs
NCBI-GeneID: 109973254
NCBI-ProteinID: XP_020478344
Position
Unknown
AA seq 823 aa AA seqDB search
MDGEDDEFMSGNRSDDGGGTPVQDEHPVSDGEEMRSDGHQSEDDGSNDEDAHHTEDRREV
DSSSGNEGHRGADSDSEGEASGGHDDDDNSDSEAEAPHPAESDVESPLKRRMSGSDNEEE
SPVKHGTSDNGEGEPSSLPKRRGSSSDVEEGEVSPPHKHMGSNSDVEEGEASSPPKRRGS
ISDMEEGEASPPPKRRGSISDMEEGEASPPPKRRGSISDVEEGEASPTHKRRDSISDVEE
GEASPPLKRRGSNSDLEAGEALSPANHRGNGSDMEEGGDRPKTAPDSDSEKEDAKAVASP
DRRSNAESDSDTETPARPRAVQIDSEEEEEEKQQGGEEGGGEGGKWKAAMQSDSEEEEGG
TRKATAGSDGEQRDDNDEDEKPVKRKKAILSDSEEEEEADRPAVKRSRAVLDDENSDSDG
GSEGPDKSLAAKLRELGSDSESEDDRSKATPRKKNEKALFGSDSDSGDGDEEEKMIADIF
GESGDEEEEEFTGFNQEDLEGEKKESEKQQQQQEEESDSDEVDRSGLDTSFMSDFDIMLA
RRKAMNSRKRRHRDGGTFISDADDVVSAMITKMNEAAEEDRTLNSQKKPALKKLTLLPQV
VMHLKKQDLKETFIDSGVMSAIKEWISPLPDKSLPALRIREELLRILQELPSVSQETLKH
SGIGRAVMFLYKHPKESRTNKDLALKLINEWSRPIFGLTSNYKGMTREERQQRDLDQQMP
QKRRLSLGGQTPRRDLEKQLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEVDT
NRGPSKKGLSRVDKQMRRFADIRRLTKTGHAVKISVEGNRMPL
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggacggagaggatgacgagtttatgtccgggaaccgctcggatgatggaggcggcact
ccggttcaggatgaacacccagtgtcagacggcgaagagatgaggagcgacggacatcag
tctgaggatgacggcagtaacgatgaggacgctcaccacactgaggaccgccgagaggtt
gacagcagctctggcaacgagggccaccgaggggctgacagcgactcggagggcgaggcc
tctgggggccacgatgatgatgacaacagcgactctgaggcagaggctccccatcctgcc
gagagcgatgttgagtctccactcaaacgcaggatgagtggctcagacaacgaggaggag
tctccggtcaaacatggaacctcagacaacggggagggggagccatcgtctctccccaaa
cgcagggggagcagctcagatgtggaggagggggaggtgtcacctccccacaagcacatg
gggagcaactcagatgtggaggagggggaggcatcgtctcctcccaagcgcaggggcagc
atctctgacatggaggagggggaggcatcacctccccccaagcgcaggggcagcatctct
gacatggaggagggggaggcatcacctccccccaagcgcaggggcagcatctctgacgtg
gaggagggggaggcatcacctacccacaagcgcagggacagcatctctgacgtggaggag
ggggaggcatcacctcccctcaagcgcagggggagcaactcagacttggaggcaggggag
gcattgtctcctgccaaccacaggggcaatggctcagacatggaggagggaggtgacaga
cctaaaacagctccagacagcgattcagagaaggaggatgccaaagccgtggcatcccct
gaccgccggtccaacgccgaaagtgactctgacacagagacgcctgccagacccagggca
gtgcagatagactctgaggaggaggaggaggagaaacagcagggtggggaggagggagga
ggagagggggggaagtggaaggctgcgatgcaatctgacagtgaggaggaagagggagga
acgaggaaggccacagcaggaagtgatggagagcagagagacgacaacgatgaagatgag
aagccagtgaagaggaagaaggcaatcctgtcagacagcgaggaggaggaggaggcagac
agaccagcagtgaagaggagtcgggcagtgttggacgatgagaactcagacagcgatggc
ggctcagagggtcctgataagagtctggcggccaaactgagggagctcggctcggacagc
gagagtgaggacgacaggtcgaaggccacgcccaggaagaagaatgagaaggcactgttc
ggcagtgacagcgactccggagacggcgacgaggaggagaaaatgatcgctgacatcttt
ggagagtctggagacgaggaggaggaggagttcacgggcttcaaccaggaggacctggag
ggggagaagaaggagtcggagaagcagcagcagcagcaggaagaggagtctgactctgat
gaagtcgaccgcagcggcctagataccagcttcatgtctgacttcgacatcatgctcgct
cggaggaaagccatgaacagtaggaagaggcggcaccgtgatggagggacattcatcagc
gacgccgacgatgtggtcagcgccatgatcaccaagatgaacgaggccgcagaggaggat
cgaactctgaacagtcagaagaagccggcactgaaaaaactcactctgctgccacaggtc
gtcatgcacctgaagaagcaggacttgaaggagacgtttattgacagtggggtgatgtcc
gccattaaggagtggatcagtcctctcccagacaaatcgctgcctgctctcagaatcaga
gaggagctgctcaggatcctacaggagctgcccagcgtgagtcaggagactctgaagcac
agcggcatcggccgggccgtcatgtttctgtacaaacatcccaaagagtctcggaccaac
aaagacctagcgctcaagctcatcaatgagtggtcgcggccgatcttcgggttgacgtcc
aactataagggaatgacgagagaggagcgacagcagagggacctggaccagcagatgcct
cagaaacgacggctgagcttgggaggtcagacgcctcggagggacctggagaaacagctg
actggagaggaaaaagctctgcgacctggtgaccctgggttctgtgccagggctcgggtc
ccaatgccctccaacaaagactatgtggtacgacccaagtggaacgtagaggtggacacc
aacaggggcccgtcgaagaaggggttatcccgtgtcgataaacagatgcgtagatttgct
gacatccgccgccttacgaagacgggtcacgcagttaaaatcagtgtggaaggaaaccgg
atgccgctctga

DBGET integrated database retrieval system