KEGG   Monopterus albus (swamp eel): 109974816Help
Entry
109974816         CDS       T05607                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00071  Fatty acid degradation
malb01212  Fatty acid metabolism
malb03320  PPAR signaling pathway
malb04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109974816
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109974816
   03320 PPAR signaling pathway
    109974816
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:malb03029]
    109974816
Enzymes [BR:malb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     109974816
Mitochondrial biogenesis [BR:malb03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    109974816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPT_N PBP_like_2
Motif
Other DBs
NCBI-GeneID: 109974816
NCBI-ProteinID: XP_020480878
Position
Unknown
AA seq 94 aa AA seqDB search
MAEAHQAVAFQFTVTPEGINLQLSHQALTEIYLSGVRSWKKRVIRLKNSVITGVYPASPS
SWLFVVIAILATMYTRSDPSMGLIAKIQEHLPVR
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcccaccaggctgtggccttccagttcacggttaccccggagggcattaac
ctgcagctatcccaccaggccctcactgaaatctacctctctggtgtgcgctcctggaag
aagcgtgtcatcagactcaagaacagtgtgataactggggtatatcctgccagcccttcc
tcctggctttttgtggttatagcaatcctggctactatgtacactcgctctgacccctcc
atgggactcatagccaagatacaggagcacctgccagtcaggtaa

DBGET integrated database retrieval system