KEGG   Monopterus albus (swamp eel): 109974853Help
Entry
109974853         CDS       T05607                                 

Definition
(RefSeq) tetraspanin-12-like
  KO
K17355  tetraspanin-12
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    109974853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 109974853
NCBI-ProteinID: XP_020480933
Position
Unknown
AA seq 307 aa AA seqDB search
MAREDAVRCLRCLLYALNLLFWLMSACVLGVAAWIRDSLNTVLTLTAHTRLEEAAVLTYS
PAVHPVVIAVCCFLLIVAMVGYCGTLRCNLLLLSWYFCSLLVIFCVELASAVWTYDQSSV
QRSDMISLKSRMSNYGLQRYQWLTHTWNSFQTEFKCCGVIYFTDWLEMTEMEWPPDSCCF
NQYPGCARHAHYHDLSDLHQDGCGPKIYSFIRGTKQLQVLRFLGVSIGVAQILAMALTLM
LLWALYYGRKSSELDSTTLEMALDDSTLLTMTHGPPSEATKLGCNHTNKGCPNTTANDHQ
FEMEHLS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggctcgggaggacgcggtgaggtgtctgcgctgtctgctctatgcgctcaacttactg
ttctggctgatgtcagcatgtgtgctgggagtggcagcgtggatcagagactctctgaac
accgtcctgaccctgacagcccacaccaggctggaagaagcagccgtgctcacatattct
ccagctgtgcatcctgttgtcatcgctgtgtgctgcttcctcctcattgtcgccatggtg
gggtactgcggcacgctcagatgcaatctgctgctactgtcctggtatttctgcagtctt
ttagttatcttctgtgtggagctggccagcgctgtctggacctatgaccagtcgtcggtg
cagcgctcagatatgatcagcctgaagtctcggatgtcgaattacggcctgcagcgttac
cagtggctcacacacacctggaacagcttccagacagagtttaaatgctgtggtgtgatc
tacttcactgattggttggagatgacagagatggagtggccacctgactcctgctgcttc
aatcagtatccaggctgcgcccgtcatgcccactaccatgacctcagcgacctgcaccag
gacggctgtggtccaaagatctacagttttattcgtgggacaaagcagctgcaggtgctg
cgtttccttggtgtgtccatcggtgtggctcagatcctggccatggcgctcaccctcatg
ctgctatgggcactgtattatggacgcaagtcttcagagctggactccacaacactggaa
atggcactggatgactccaccctcctcacaatgacacatggacctccgtctgaagctaca
aaactgggctgcaaccacacaaataaaggctgtcctaacaccacagcaaatgaccaccag
tttgagatggagcatctgtcctag

DBGET integrated database retrieval system