KEGG   Marinovum algicola: MALG_00150Help
Entry
MALG_00150        CDS       T03981                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
malg  Marinovum algicola
Pathway
malg00020  Citrate cycle (TCA cycle)
malg00620  Pyruvate metabolism
malg01100  Metabolic pathways
malg01120  Microbial metabolism in diverse environments
malg01200  Carbon metabolism
malg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:malg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MALG_00150
   00620 Pyruvate metabolism
    MALG_00150
Enzymes [BR:malg01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     MALG_00150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA CPSase_L_D2 Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 Dala_Dala_lig_C ATP-grasp_3 HlyD_3 ATPgrasp_Ter HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AKO95364
UniProt: A0A0H4KSL5
Position
complement(161092..164538)
Genome map
AA seq 1148 aa AA seqDB search
MPDFQKILIANRGEIAIRIMRAANEMGKRTVAVYAEEDKLGLHRFKADEAYRIGEGLGPV
AAYLSIEEIIRVAKMSGADAIHPGYGLLSENPDFVDACDAAGITFIGPKAETMRALGDKA
SARRVAIEAEVPVIPATEVLGDDMAKIKKQAAEVGYPLMLKASWGGGGRGMRPISSEDEL
EEKVLEGRREAEAAFGNGEGYLEKMITRARHVEVQILGDKQGNIYHLYERDCSVQRRNQK
VVERAPAPYLSEAQREEICELGRKICAHVNYECAGTVEFLMDMETGKFYFIEVNPRVQVE
HTVTEEVTGIDIVQAQILIAEGKSLAEATGKASQYDIRLNGHALQTRVTTEDPQNNFIPD
YGRITAYRSATGMGIRLDGGTAYAGGVITRYYDSLLTKVTAWAQTPEKAISRMDRALREF
RVRGVSTNIAFVENLLKHPTFLNNQYHTKFIDETPELFDFKKRRDRGTKVLTYIADITVN
GHPEVQGRPKPHPELKPAKPPQVPFGEKPAYGTRNLLEEKGPQAVADWMAAQKQVLITDT
AMRDGHQSLLATRMRSIDMIKVAPAYAAKLPQLFSVECWGGATFDVAYRFLQECPWQRLR
DIRAAMPNVMTQMLLRASNGVGYTNYPDNVVQFFVKQAAESGVDVFRVFDSLNWVENMRV
AMDAVQEAGKVCEGTICYTGDFRDPDRSKYDLKYYVEMGQQLRDGGAHVLGLKDMAGLLK
PSAAGALIKTLKEEVGLPIHFHTHDTSGAGIGTIMAAAEAGVDAVDGAMDALSGNTSQPT
LGSIVEALRFTERDTGLDIAAIREISNYWEAVRGQYAAFESSMQAPASEVYLHEMPGGQF
TNLKTQARSLGLEERWHEVAQAYADVNMMFGDIVKVTPSSKVVGDMALMMVSQGLSRAQV
EDPDTDVAFPDSVIDMMKGNLGQPPGGFPASILKKVLKGEKPNLERPGKHLKPVDIEATR
KQVSEELNGYEVDDEDLNGYLMYPKVFLDYMGRHRSYGPVRALPTHTFFYGMQPGEEITA
EIDPGKTLEIRLQAVGETGEDGEVKVFFELNGQPRVIRVPDRKAAASSAARPKAELGNDK
HIGAPMPGVVATVAVKPGDKVKEGDLLLTIEAMKMETGIHAERAAIVTAVHVQPGGQIDA
KDLLVELD
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atgcctgactttcagaagatcctcatcgccaaccgtggcgagatcgccattcgcatcatg
cgcgccgccaacgagatgggcaaacggaccgtcgcggtctatgccgaggaagacaaactc
ggcctgcaccggttcaaggcggacgaagcgtatcgcatcggcgagggtctggggccggtt
gcggcgtatctgagcatcgaggagatcatccgcgttgccaagatgtcgggcgccgatgcg
atccacccgggctatggcctgttgtcggagaaccccgatttcgtggatgcctgcgacgcc
gccggcatcacctttatcggccccaaggccgagaccatgcgcgcccttggcgacaaggcc
agcgcgcggcgcgtggcgatcgaggccgaggtgccggtgatcccggcgaccgaggtgctg
ggcgatgacatggccaagatcaagaaacaggccgccgaagtgggctatccgctgatgctc
aaggcctcctggggcggcggcggtcgcggcatgcggccgatctcttccgaggacgagctc
gaggagaaggtgctcgaaggccggcgcgaggccgaggccgcctttggcaacggcgagggc
tatctggaaaagatgatcacccgcgcccgccacgtcgaggtgcagatcctcggcgacaag
cagggcaacatctaccacctctacgaacgcgactgctcggtccagaggcgcaaccagaag
gtcgtggaacgcgcgcccgcgccctatctgagcgaagcacagcgcgaggaaatctgtgag
ctcggccgcaagatctgcgcccatgtgaactatgaatgcgccggcaccgtcgaattcctg
atggatatggagaccggcaagttctacttcatcgaggtcaacccgcgggtgcaggtggag
cacaccgtcaccgaggaagtgaccggcatcgacatcgtgcaggcgcaaatcctgattgcc
gagggcaagtcgctggccgaggccaccggcaaggccagccagtacgacatccgcctcaac
ggccacgcgttgcaaacccgggtcaccaccgaggatccgcagaacaacttcatccccgat
tatggccggatcaccgcctatcgctcggccaccggcatgggcatccggctcgatggcggc
accgcctatgccggcggcgtcatcacccgctactatgacagccttctgaccaaggtcacc
gcctgggcgcagacaccggaaaaggcgatttcgcgcatggaccgcgcgctgcgcgaattc
cgcgtgcgcggcgtcagcaccaacatcgcctttgtcgagaacctgctcaagcacccgacc
tttctcaacaaccagtaccacaccaagttcatcgacgagacgcccgagcttttcgatttc
aagaagcgccgcgatcggggcaccaaggttctgacctatatcgccgacatcacggtgaac
ggtcaccccgaggtgcagggccgtcccaagccgcaccccgagctgaaaccggccaagccg
ccgcaggtgccctttggcgagaaacctgcctacggcacccgcaacctgctcgaagaaaag
ggcccgcaggcggtagccgactggatggccgcgcagaagcaggttctgatcaccgacacc
gcgatgcgcgacgggcaccagtcgcttctggcgacccggatgcgctcgatcgacatgatc
aaggtggcgcctgcttatgccgccaagctgccgcagctgttttcggtggaatgctggggc
ggcgcgaccttcgacgtcgcctaccgcttccttcaggaatgcccctggcagcggctgcgc
gacatccgcgcggcgatgcccaacgtgatgacgcagatgctgctgcgcgcctcgaacggg
gtgggctataccaactacccagacaacgtggtgcagttctttgtcaaacaggcggcggaa
tccggcgtcgacgtcttccgcgtcttcgacagcctgaactgggtcgagaacatgcgcgtg
gcgatggacgcggtgcaggaggcgggcaaggtctgcgaaggcacgatctgctacaccggc
gatttccgcgatccggaccggtcgaaatacgacctgaagtattatgtcgagatgggccag
cagctgcgcgacggtggcgcgcatgtgctgggcctcaaggacatggccgggctgctgaaa
ccttcggccgccggcgcgctgatcaagacgctgaaggaagaggtcggcctgccgatccat
ttccacacccacgacacctcgggcgccggcatcggcacgatcatggctgcggccgaagcc
ggggtcgatgccgtcgatggcgcgatggatgcgctctcgggcaacacctcgcagccgacg
ttggggtcgatcgtcgaggcgctgcgctttaccgagcgtgacaccgggctcgacattgcc
gcgatccgcgagatttcgaactactgggaagcggtgcgcggccagtacgccgcctttgaa
tcgagcatgcaggctccggcttcggaggtctatctgcacgagatgcccggcggccagttc
accaacctcaagacccaggcccgttcgctcgggcttgaggagcgctggcacgaggtggcg
caggcctatgccgacgtcaacatgatgttcggcgatatcgtcaaagtcacgccgtcatcg
aaagtggtgggcgacatggcgctgatgatggtgtcgcagggtctgagccgggcgcaggtg
gaagaccccgacaccgacgtggccttcccggattcggtgatcgacatgatgaagggcaac
ctcggccagccgccgggcggcttccccgcgagcatcctgaaaaaggtgctcaagggcgag
aaacccaacctcgagcgccccggcaagcatctcaagccggtcgatatcgaggcgacccgc
aagcaggtgtcggaagaactcaatggctatgaggtggatgacgaggatctgaatggctac
ctgatgtatcccaaggtcttcctcgactacatgggccgtcatcgcagctatggcccggtg
cgcgcgctgccaacgcataccttcttctacggcatgcagcccggcgaagagatcacggcg
gaaatcgaccccggcaagacgctggaaatccggcttcaggcggttggcgagaccggcgag
gacggcgaggtgaaggtgttcttcgaactcaacggccagccgcgcgtgatccgcgtgccc
gaccgcaaggccgccgcctcttccgccgcacggcccaaggccgagctgggcaacgacaag
cacatcggcgcgccgatgccgggcgtcgtggcgacggtggccgtcaagccgggcgacaag
gtcaaggaaggcgatctgctgctgaccatcgaggcgatgaagatggaaaccggcatccac
gctgagagggccgccattgtcacggcggtccacgttcagcccggcggccagatcgacgcc
aaggacctgctggtcgagctggactga

DBGET integrated database retrieval system