KEGG   Marinovum algicola: MALG_01708Help
Entry
MALG_01708        CDS       T03981                                 

Definition
(GenBank) amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
  KO
K10016  histidine transport system permease protein
Organism
malg  Marinovum algicola
Pathway
malg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:malg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MALG_01708
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:malg02000]
    MALG_01708
Transporters [BR:malg02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    MALG_01708
   Histidine transporter
    MALG_01708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AKO96882
UniProt: A0A0H4KS06
Position
complement(1742623..1743312)
Genome map
AA seq 229 aa AA seqDB search
MNLLLDYQDQLINGTIMTIKLALTSLVIALIFGLLGAWAKLSSNRAAQRMAGAYTTVVRG
VPDLVLILLVFFGGQVTLNNLGAATGLWGYVEVSQFAAGAGTIGVIFGAYFTETFRGAIM
AIPRGQIEAGISCGMRRSLIFRHVIWPQMIRFALPGFTNNWLVQLKTTALVSVIGLQDLV
YNAFTAGRSTGQLFTFMAAAFVIYLLLTGVSDLALRGLERHYNRGVVRA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgctcttggactaccaagaccaattgatcaacggcacgatcatgaccatcaag
ctggcgctgacatcgctggtgatcgcgctgatcttcggcctacttggcgcttgggcaaaa
ctctcgtccaatcgcgcggcgcagcggatggctggcgcctatacgaccgtcgtgcgcggc
gtgcccgatctggtgctgatcctgctggtgttcttcggcggacaggtgacccttaacaat
ctcggcgcggcgacggggctttggggctatgtcgaggtcagccagttcgcggctggtgca
ggcaccatcggggtgatcttcggcgcctatttcaccgaaacgtttcgcggcgccataatg
gccattccccgcggccagatcgaggcgggcatcagctgcggaatgcgcaggtcgctgatc
tttcgtcatgtcatctggccccagatgatccgctttgctttgccgggcttcaccaacaat
tggttggtgcagctcaagaccacggcgctggtgtcggtcatcgggcttcaggatctggtc
tacaatgccttcaccgccggccgctcgaccggccagcttttcaccttcatggcggcggcc
tttgttatctatctgctgctgaccggcgtctccgatttagctctgcgcgggctggagcgt
cattacaaccgtggcgtggtgagggcgtga

DBGET integrated database retrieval system