KEGG   Marinovum algicola: MALG_01996Help
Entry
MALG_01996        CDS       T03981                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K23463  (Z)-2-((N-methylformamido)methylene)-5-hydroxybutyrolactone dehydrogenase [EC:1.2.1.-]
Organism
malg  Marinovum algicola
Brite
KEGG Orthology (KO) [BR:malg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MALG_01996
Enzymes [BR:malg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     MALG_01996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKO97165
UniProt: A0A0H4KUH7
Position
2064365..2065843
Genome map
AA seq 492 aa AA seqDB search
MTDTPHYQLFIDGQWTEGADGQTMSTLNPATGEEWATFACAAPADIDRAVTAARRALTDP
AWRDLSQTARGKLLHRLADLIEQHAAGIGRIETTDSGKLLAETASQTAYVGDYYRYYAGL
ADKIEGAVLPIDKPDMHVFTRREPIGVVVAIVPWNAQMFLTATKLGPALAAGCTVVLKAS
EVAPAPMLEFARLIEEAGFPPGVVSVLTGDAEACAIPLTRHPGVDRIAFTGGPETARHVV
RNSAESFAVTTLELGGKSPILVFEDADLEGAANGLIAGNFGASGQSCVAGSRGLVHRPVF
DALVARIEEKMAGVTIGDPLEAQTQIGPLCTAAQIAKIEATLAAATAQGATIRFGGAPLA
RPGNYMPPTLVECAGPDTATLHVEMFGPVMSLLPFDSEEEAIALANDTPFGLGSGVFTDN
LARAHRVSARLKAGICWVNTYRAVSPIAPFGGYGQSGYGREAGIEAIQDYTRTKTTWIST
SDRPMANPFVMR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacactccgcattaccagcttttcatcgacggccaatggaccgagggcgcggat
ggccagaccatgagcacgctaaaccccgcgaccggtgaggaatgggcgaccttcgcctgc
gccgcgcccgcggacatcgaccgcgccgtgactgccgcccgccgcgcgctgaccgatccg
gcctggcgtgacctcagccagaccgcgcgcggcaagctgctccatcgcctcgccgatctg
atcgaacaacacgccgccgggatcggccggatcgagaccacggacagtggcaagctcctg
gccgaaaccgccagccagaccgcctatgtaggcgattactatcgctattacgccggcctc
gccgacaagatcgaaggcgcggtgctgccgatcgacaaacccgacatgcatgtctttacc
cgccgcgagccgattggtgtggtggtggcgatcgtgccctggaacgcgcagatgttcctg
actgccaccaagctcggcccggccctggcggcgggctgtacggtggttctgaaagcctcc
gaggtggcccccgccccgatgctcgagtttgcccggctgatcgaggaggcgggctttccg
cccggcgtcgtctcggtgctgaccggtgacgccgaggcctgtgccattccgctcacccgt
caccccggggtcgaccggatcgcctttaccggcgggccggaaaccgcgcggcacgtggtg
cgcaattcggccgaaagcttcgcggtgacgacgctggaacttggcggcaaatccccgatt
ctggtgttcgaggatgccgatctcgaaggtgcggccaacgggctgattgcgggcaatttc
ggcgcctccgggcagagctgtgtcgccggttcgcgcgggctggtgcatcgcccggtcttc
gacgcgcttgtcgcccggatcgaggaaaagatggccggggtcaccattggcgacccgctg
gaggcgcagacgcagatcggcccgctctgcaccgcggcgcagatcgcgaagatcgaggcc
acgctggccgccgccacggcccagggcgcgacgatccgctttggcggcgcgccgctcgcg
cgtcccggcaactacatgcccccgacgctggtggaatgcgccggccccgacaccgcgaca
ttgcatgtcgagatgttcggcccggtgatgtcgctgctgccgttcgacagcgaggaagag
gcaatcgccctggccaatgacacgccgttcggcctcggctcgggcgtctttaccgataac
ctcgcccgcgcgcaccgggtctcggcgcggctcaaggcggggatatgctgggtgaacacc
taccgcgcggtgtcgccgatcgcgccgtttggcggctatggccagtccggctacgggcgc
gaggccgggatcgaggcgatccaggactacacccgtaccaagaccacctggatcagcacc
tcggaccggccgatggccaatcccttcgtgatgcgctga

DBGET integrated database retrieval system