KEGG   Marinovum algicola: MALG_02528Help
Entry
MALG_02528        CDS       T03981                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
malg  Marinovum algicola
Pathway
malg00071  Fatty acid degradation
malg00072  Synthesis and degradation of ketone bodies
malg00280  Valine, leucine and isoleucine degradation
malg00310  Lysine degradation
malg00362  Benzoate degradation
malg00380  Tryptophan metabolism
malg00620  Pyruvate metabolism
malg00630  Glyoxylate and dicarboxylate metabolism
malg00640  Propanoate metabolism
malg00650  Butanoate metabolism
malg00900  Terpenoid backbone biosynthesis
malg01100  Metabolic pathways
malg01110  Biosynthesis of secondary metabolites
malg01120  Microbial metabolism in diverse environments
malg01130  Biosynthesis of antibiotics
malg01200  Carbon metabolism
malg01212  Fatty acid metabolism
malg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:malg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MALG_02528
   00630 Glyoxylate and dicarboxylate metabolism
    MALG_02528
   00640 Propanoate metabolism
    MALG_02528
   00650 Butanoate metabolism
    MALG_02528
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MALG_02528
   00072 Synthesis and degradation of ketone bodies
    MALG_02528
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MALG_02528
   00310 Lysine degradation
    MALG_02528
   00380 Tryptophan metabolism
    MALG_02528
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MALG_02528
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MALG_02528
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MALG_02528
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malg04147]
    MALG_02528
Enzymes [BR:malg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MALG_02528
Exosome [BR:malg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MALG_02528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKO97692
UniProt: A0A0H4KUD2
Position
2591584..2592795
Genome map
AA seq 403 aa AA seqDB search
MTDAYIYDALRSPRGKGRKDGSLHEVTSLRLSAQILNAVKDRNGLDGHAVEDVIWGNVTQ
VGEQGGCLARSAVLASDLDERIPGLSINRFCASGMEAVNLAANQVRGGAGRAYIAGGVEM
MGRVAMGSDGAAIAVDPSLAMESYFVPQGISADIIATEYGFSRDDADALAVESQKRAAAA
WQDKRFDKSVVAVRDVNGLPILEADEYMRPGTDMQSLGGLKPAFKDMGETMPGFDAVALM
KYPHLERINHIHHAGNSSGIVDGAAAVLIGNKEFGEAHGLKPRARIRATAKIGTDPTIML
TGPVPVTEKILADSGMSISDIDLFEVNEAFASVVLRFMQAFDVDHDKVNVNGGAIAMGHP
LGATGAIIIGTLLDELERSGKGVGLATLCIASGMGAATIIERL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgcctatatttacgacgccctgcgcagcccgcgcggcaagggccgcaaggat
ggctccctgcacgaggtgaccagcctgcggctttcggcccagatcctgaacgcggtcaag
gaccgcaacgggcttgacggccatgccgtcgaggacgtgatctggggcaatgtcacccag
gtgggcgaacagggcggctgcctggcgcgctcggcggtgctggcctccgatcttgacgaa
cgcattcccggcctctcgatcaaccgcttctgcgcctccggcatggaggccgtgaacctg
gccgccaaccaggtccgcggcggcgccggccgggcctatatcgccggcggggtcgagatg
atgggccgcgtcgccatgggcagcgatggcgcggcgattgccgtcgatccgtcgctggcg
atggagagctatttcgtgccgcagggcatttcggccgatatcatcgccaccgaatacggc
ttttcccgcgatgacgccgatgcgctggcggtggagagccagaagcgcgccgccgccgcc
tggcaggacaagcggttcgacaaatccgttgtcgcggtgcgtgacgtcaacgggctgccg
atcctcgaagcggacgaatacatgcggcccggcaccgacatgcaaagcctcggcggcctc
aagcccgccttcaaggacatgggcgaaaccatgcccggcttcgatgccgtggcgctgatg
aaatatccgcatctcgagcgcatcaaccacatccaccacgccggcaattcctcgggcatc
gtcgatggcgccgccgccgtgctgatcggcaacaaggaattcggcgaggcgcatgggctc
aagccccgggcccgcatccgcgccactgccaagatcggcaccgatccgacgatcatgctg
accggcccggtgccggtgaccgagaaaattctcgccgacagcgggatgtcgatctccgac
atcgatctcttcgaggtcaacgaggcctttgccagcgtcgtcttgcgcttcatgcaggcg
ttcgatgtcgatcatgacaaggtcaacgtcaacggcggcgccatcgccatgggccatccg
ctgggcgccaccggcgcgatcatcatcggcaccctgctcgacgagctggagcgcagcggc
aagggcgtgggcctcgccacgctctgcattgcgtccggcatgggggccgcaacgatcatc
gagcgcctgtga

DBGET integrated database retrieval system