KEGG   Marinovum algicola: MALG_02629Help
Entry
MALG_02629        CDS       T03981                                 

Definition
(GenBank) Dehydrogenase with variable specificity
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
malg  Marinovum algicola
Pathway
malg00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:malg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    MALG_02629
Enzymes [BR:malg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     MALG_02629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AKO97787
UniProt: A0A0H4KUJ9
Position
2706489..2707289
Genome map
AA seq 266 aa AA seqDB search
MGFSIEGKTAIVTGAANGIGLAIGRHFIDKGANVVFADMDEAKLADEVGETKDDGPARYF
AGDLRERLTLANLLSATLDAFDRVDILVNGSRQILSSDPLDMDDETVETLLQQNLLTSLR
LSQLVARRMIKQGEGQEEGQLGSIVNVSSIAARRTHPELLAYSVSTAALDQMTRSLAVAL
APHRIRVNGVAFGSVMSASLKGALKENREFRSEIEDNTPLGRIASPGELAEATQFLASEG
AGFVTGQIMTVDGGRTLVDPVTAPAH
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctcgatcgaaggcaagaccgccatcgtgaccggggcggccaatggcatcggg
ctggccatcgggcggcatttcatcgacaagggcgccaatgtggtctttgccgacatggac
gaagccaagctggccgacgaggtgggcgaaaccaaggatgacggcccggcgcgctatttc
gccggcgacctgcgcgaaagactgacgctggccaatctgctctcggccaccctcgacgcc
tttgaccgggtggatatcctagtcaacggcagccggcagatcctctcgtccgatccgctc
gacatggacgacgaaaccgtcgaaactttgttgcagcaaaaccttttgacctcgctccgg
ctgtcgcagctggttgcccggcggatgatcaagcagggcgaaggccaggaagagggccag
ctcggttcgatcgtcaatgtctcgtcgattgccgcgcggcggacgcatcccgagcttctg
gcctattcggtctcgaccgccgcgctcgaccagatgacccgctcgctggcggttgcgctg
gcgccgcatcgcatccgggtcaacggcgtggccttcggctcggtgatgtcggccagcctc
aagggcgcgctcaaggaaaaccgagagttccgcagcgagatcgaggacaacacgccgctg
ggccgcatcgcctcgccaggcgaactggccgaggcgacgcaattcctggcctccgagggc
gccggatttgtcaccgggcagatcatgacggtggatggcgggcgcacgctggttgacccg
gtgacggcgccggcgcattga

DBGET integrated database retrieval system