KEGG   Marinovum algicola: MALG_03524Help
Entry
MALG_03524        CDS       T03981                                 

Definition
(GenBank) putative amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
malg  Marinovum algicola
Brite
KEGG Orthology (KO) [BR:malg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MALG_03524
Enzymes [BR:malg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     MALG_03524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AKO98667
UniProt: A0A0H4KXA8
Position
complement(3611940..3612770)
Genome map
AA seq 276 aa AA seqDB search
MRSALLQLSSTDDPAENLAITAARIDAAVAEGAGFVLTPEVTNCVSASRTRQQAVLQQEK
DDITLAGLRDLAARRGIWLSIGSLALKTGAADGRFVNRSFLIGPAGDIVARYDKIHMFDV
QVSETETYRESAGFRPGTAAVVAETPFATLGLSICYDLRFPQLYRALAHAGAEVLLVPSA
FSPVTGAAHWQPLLRARAIESGAWVLAAAQCGTHDAVRGKQRTTYGHSMAVAPWGEILAE
AGEAPEVLWVDLSREAVDKARERVPSLTHDRDFTGP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcgcgctgctgcaactgtcgtccaccgacgatccggcggaaaacctcgccatc
acggcggcgcggatcgacgccgcggtggccgagggcgcggggttcgttctgacgcccgag
gtgacgaattgcgtctcggccagccggacccggcagcaggcggtgctgcaacaggagaaa
gacgacatcaccctcgccggattgcgcgatctggcggcgcggcgggggatctggctctcg
atcggatcgctggcgttgaaaaccggcgcggccgacgggcgtttcgtcaaccgctccttc
ctgatcggaccggcgggcgacatcgtcgcgcgttatgacaagatccacatgttcgacgtg
caggtcagcgagaccgagacctatcgcgaaagcgcgggcttccgccccggcaccgcggcg
gtggtggccgagacgccctttgccaccctcggcctgagcatctgctacgatctgcggttc
ccgcagctttaccgcgcgctggctcatgccggggccgaggtgctgctggtgccatcggcc
ttttcgccggtcactggcgccgcccattggcaaccgttgctgcgtgcccgggcgatcgag
agcggggcctgggtgctggcggcggcgcaatgcggcacgcatgatgcggtgcgtggcaag
cagcgcacaacatatgggcattccatggcagtggcgccctggggtgagatcctggccgag
gccggcgaggcgccggaggtgctttgggttgacctgagccgggaagcggtggacaaagcc
cgcgagcgggtgccctcgctcacccatgaccgtgacttcacaggaccctga

DBGET integrated database retrieval system