KEGG   Marinovum algicola: MALG_04383Help
Entry
MALG_04383        CDS       T03981                                 

Definition
(GenBank) Ketoglutarate semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
malg  Marinovum algicola
Pathway
malg00040  Pentose and glucuronate interconversions
malg00053  Ascorbate and aldarate metabolism
malg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:malg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MALG_04383
   00053 Ascorbate and aldarate metabolism
    MALG_04383
Enzymes [BR:malg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     MALG_04383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF3670
Motif
Other DBs
NCBI-ProteinID: AKO99512
UniProt: A0A0H4KZT1
Position
pMaD4:99981..101492
Genome map
AA seq 503 aa AA seqDB search
MSFAPHGNHLIAGEWIGSDQTFASDPANGPSHDFSRGTPALVDQACEAAEAAFWRYGATT
RAERAAFLNAIADEIEARAEAITEIGSQETGLPEARLNGERGRTTGQLRLFAAHILEGDY
LDRRHDAALPERQPLPRPDLRMVQRPIGPVAVFGASNFPLAFSTAGGDTAAALAAGCPVV
VKGHSAHPGTGEIVAEAVQAAAEKCAMPRGVFSFIQGGKRDVGQRLVQHPLIKAVGFTGS
LGGGRALFDLCAQRPEPIPFFGELGSVNPMFLLPEAVKARGAAIGEGWAASLLMGAGQFC
TNPGIAVVARGAEGDAFVRAAAEALQDAPAQVMLTDGIAHAYRDGTARLDGRNGVRPVLT
TDSEGRRALPNLFETEASVYLGDHALGEEVFGPLGLVVRVEGADEMAALAKGLDGQLTVT
LHMDDGDTEAARRLMPIVERKAGRLLVNGFPTGVEVADTMVHGGPYPASTNFGATSVGTL
SIRRFLRPVCYQNMPEALLPADL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagctttgccccgcatggaaaccacctgatcgctggcgaatggatcggctcggaccag
acctttgcgtccgacccggcaaacggcccgtcgcatgacttcagccgcggcaccccggcg
ctggtcgatcaggcctgcgaggcggcggaagcggccttctggcgttacggcgcgacaacg
cgggccgagcgggcggcctttctcaacgccatcgccgacgagatcgaggcccgcgccgag
gcgatcaccgagatcggcagccaggaaaccggcctgccggaagcgcggctcaacggcgaa
cgcggccgcaccaccggccagctccggctctttgccgcgcatatcctggagggcgactac
ctcgaccgccgccacgacgcggccctgccggagcggcagccgctgccgcgccccgatctg
cgcatggtgcaacgtccgatcggcccggttgcggtctttggcgcctcgaactttccgctg
gcgttctccaccgccggcggcgataccgcggcggcgctggcggccggctgtccggtggtg
gtcaagggccattccgcccatcccggcaccggcgagatcgtcgccgaggcggtgcaggcg
gcggcggaaaaatgtgccatgccccggggcgtcttttctttcatccagggcggcaaacgc
gatgtcggccagcggctggtgcagcatccgctgatcaaggcggtgggctttaccgggtcg
ctcggcggcgggcgggcgctcttcgatctctgcgcgcaacggcccgagccgatcccgttt
ttcggcgagctgggctcggtcaatccgatgttcctgctgcccgaggcggtcaaggcgcgg
ggcgcggccatcggcgaaggctgggcggcatcgctgctcatgggcgcgggccagttctgc
accaatcccggcattgccgtggtggcccggggtgccgaaggcgacgcctttgtgcgggcg
gcggccgaggcgctgcaagacgcgccggcgcaggtcatgctgaccgacgggattgcgcat
gcctatcgcgacggcacggcgcggctggacggccggaacggagtgcgcccggtgctcacc
accgacagcgagggccgcagggcgctgcccaatctcttcgagaccgaggccagcgtctat
ctcggcgatcacgcgcttggcgaagaggtctttggcccgctcggcctcgtggtgcgggtc
gagggcgccgacgagatggcggcgctggcgaaagggctcgacgggcagctgaccgtcaca
ctgcacatggacgacggcgacaccgaagcggcgcgccggctgatgcccatcgtggagcgc
aaggccgggcggttgctggtcaacggcttcccgaccggcgtcgaagtggccgataccatg
gtgcacggcgggccgtatccggcctcgaccaactttggcgcaacctcggtcggcaccctg
tcgatccgccgtttcctgcggccggtgtgttaccagaacatgcccgaggcgctgctgccc
gcggatctctga

DBGET integrated database retrieval system