KEGG   Marinovum algicola: MALG_04840Help
Entry
MALG_04840        CDS       T03981                                 

Definition
(GenBank) plasmid replication protein DnaA-like-II
Organism
malg  Marinovum algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaA_N HTH_38 Phage_rep_O HTH_Crp_2 HTH_11
Motif
Other DBs
NCBI-ProteinID: AKO99967
UniProt: A0A0H4L178
Position
pMaD8:complement(join(111252..111292,1..670))
Genome map
AA seq 236 aa AA seqDB search
MDAKRYTGPQAGSQKYDLLTALSVAGLSGSPGFQTSMLRLVALVTARYNWGRNELTVGQR
EMARLWSVDERTVKREIKRLTAASILLQLRPGVRGRVAAYRLNIAEIHRLSAPVWDRVGP
DYADRMAQQAPPSAAPTVTQVDFAAAQPADPPQQIDPPAGQGGPWARTLARLAQLEPALH
RSWFAALTPGACEAGVLTLRAPSQFQARYVQTHHQRLLLGTAQMEFPDLRRIEIYA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaagcggtataccgggccacaggcggggtcacagaagtacgatcttctgact
gcgctgtcggtggcggggttgagcggctctcccgggtttcaaacctcgatgctgcggttg
gtggcgttggtgacggcacgctacaactggggccgcaacgagctgaccgtcgggcaacgc
gaaatggcgcggctctggtcggtcgacgaacggacggtgaaacgcgagatcaagcggctg
acggcggcgtcgatcctgcttcagcttcggccgggggtgcggggcagggtggccgcctac
cggctcaacatcgccgagatccaccggctgagcgcgccagtctgggatcgggtcggcccg
gactacgccgaccgcatggcgcagcaggcgccgccatccgcagcgcccacggtgacacag
gtcgatttcgcggcggcccaaccggcggacccaccgcagcagatcgatccacccgccggc
cagggcggtccctgggcgcgaacgctggcgcggctggcgcagctcgaaccggcattgcac
cgaagctggttcgccgcgcttacacccggggcctgcgaggcaggcgtgctgacgcttcgg
gcgccgtcgcagtttcaggcgcggtatgttcagacccatcatcagcggctgctcctgggc
accgcgcagatggaattccccgatctcaggcggatcgagatctacgcctga

DBGET integrated database retrieval system