KEGG   Massilia albidiflava: EYF70_03290
Entry
EYF70_03290       CDS       T05903                                 

Definition
(GenBank) TolC family protein
  KO
K15725  outer membrane protein, heavy metal efflux system
Organism
mali  Massilia albidiflava
Brite
KEGG Orthology (KO) [BR:mali00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mali02000]
    EYF70_03290
Transporters [BR:mali02000]
 Other transporters
  Pores ion channels [TC:1]
   EYF70_03290
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: QBH99977
UniProt: A0A411WTJ5
Position
complement(758801..760030)
AA seq 409 aa
MRLTRLPFYLVAAACLLPPLSIAQSSAQSTPAPTLHELVESAWQRAPLARTLAARQQETA
AARDIAGSWLAAAPTLGMADRSDRWTDQRNARETEVSLSAPIVLPGQHGARRQLAERAGE
ELDAQLRQARLAIAGEVRTRLWEAAAAREVLAEKRDHLHHMEELAADVERRVKAGDLARS
DALLARQEVLAATMDVALARGRAGEALARFRLVTGAATLPALEPETLPAETAATHHARLR
AAQAAETRARAAVELASASRQAAPVVALSMRRERDGNMPGVDRSIGIALQIPLSGKLRNR
PAEALAGTQLATAAAELEQTRATVDADLALAQDQLANARAALDAATARAAALREHTALFE
HAFRQGEKPLADLLRSRALTHEAEVAIRQQRVALALAHAQMNQAFGILP
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgcgtcttacacgcctgcccttttatctggtggctgccgcctgcctgctgccgcccctt
tccatcgcgcagtccagcgcgcagtccacgcccgcgccgaccctgcacgaactggtcgag
tccgcatggcagcgcgcgccgctggcccgcacgctggccgcccgccagcaggaaaccgcc
gccgcgcgcgacattgccgggtcgtggctggcggccgcgcccacgctcggcatggcggac
cgctccgaccggtggaccgaccagcgcaacgcccgcgagacggaagtgtcgctgtccgcc
cccatcgtgctgcccggccagcacggcgcgcgccgccagctggcggaacgggccggcgaa
gagctcgatgcccagctgcgccaggcccggctggccattgccggggaggtccgcacgcgg
ctgtgggaagcggccgccgcccgcgaggtgctggccgagaagcgcgaccacctgcaccac
atggaagagctggcggccgatgtcgaacgccgcgtcaaggcgggcgacctggcccgcagc
gatgccctgctggcccggcaggaagtgctggcggccaccatggatgtcgccctggcgcgc
ggccgtgccggcgaagcgctggcgcgcttccggctggtcaccggcgcagccaccctgccc
gcgctggaacccgaaacactgccggctgaaacggccgcgacgcatcatgcgcggctgcgg
gcggcgcaggcagcggagacgcgcgcccgcgcggccgtcgagctggcatcggccagccgg
caggccgcgccggtcgttgcgctgtccatgcgccgcgagcgcgacggcaacatgccgggc
gttgaccgcagcatcggcatcgcgctgcagatccccctgtccggcaagctgcgcaaccgc
ccggccgaagcactggcgggcacgcagctggcgaccgccgccgccgagctggagcagacc
cgcgccaccgtggacgccgacctggcgctcgcgcaggaccaactggccaatgcgcgcgcc
gcgctcgatgccgccacggcacgcgccgccgcgctgcgcgagcacaccgcgttgttcgag
catgcgttccggcagggtgaaaagccgctggccgacctgctgcgctcgcgcgcactgacc
cacgaagccgaagtggcgatccgccagcagcgcgtcgcgctggccctcgcccacgcccag
atgaaccaagcttttggaatcctcccatga

DBGET integrated database retrieval system