KEGG   Massilia albidiflava: EYF70_06970Help
Entry
EYF70_06970       CDS       T05903                                 

Gene name
ompR
Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
mali  Massilia albidiflava
Pathway
mali02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mali00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EYF70_06970 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mali02022]
    EYF70_06970 (ompR)
Two-component system [BR:mali02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   EYF70_06970 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: QBI00631
UniProt: A0A411WV09
Position
complement(1630373..1631155)
Genome map
AA seq 260 aa AA seqDB search
MTTSTDTGNNGTPSSTSTSHGGHQAKIMVVDDDVRLRDLLRRYLTEQGFNVFTAENATAM
NKLWLRERYDLLVLDLMLPGEDGLSICRRLRGAGDQTPIIMLTAKGEDVDRIVGLEMGAD
DYLPKPFNPRELVARIGAVLRRKAPDEIPGAPSETPQTFEFGQFVLDLGTRTLKKNGETV
PLTTGEFSVLKVFARHARQPLSREKLMELARGREYEVFDRSLDVQISRLRKLIEPDPSSP
LYIQTVWGLGYVFIPEGQPR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccacatcgaccgacaccggcaacaacggcaccccctcctccaccagcacttcccat
ggcggccaccaggccaagatcatggtcgtggacgacgacgtccgcctgcgcgacctgctg
cgccgctacctgaccgaacagggtttcaatgtgtttaccgcggaaaacgccaccgcgatg
aacaagctgtggctgcgcgagcgctacgacctgctggtactggacctgatgctgccggga
gaggatggcctgtcgatctgccgccgcctgcgcggcgccggcgaccagacgccgatcatc
atgctgaccgccaagggcgaggacgtggaccgtatcgtcggcctggaaatgggcgccgac
gactacctgccgaagccgttcaacccgcgcgaactggtggcccgcatcggcgcggtgctg
cgccgcaaggcccccgacgaaatccccggcgcgccatcggaaaccccgcagactttcgag
ttcggccagttcgtgctggacctgggcacccgcaccctgaagaagaatggcgaaacggtg
ccgctgaccaccggcgaattctcggtcctgaaagtatttgcccgccatgcgcgccagccg
ctgtcgcgcgagaagctgatggaactggcgcgcggccgcgaatacgaagtcttcgaccgt
tcgctggacgtgcagatctcgcgcctgcgcaagctgatcgagccggacccttccagcccg
ctgtacatccagaccgtgtggggcctgggctacgtgttcatcccggagggacagccgcgc
tga

DBGET integrated database retrieval system