KEGG   Massilia albidiflava: EYF70_07335Help
Entry
EYF70_07335       CDS       T05903                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mali  Massilia albidiflava
Pathway
mali00450  Selenocompound metabolism
mali00970  Aminoacyl-tRNA biosynthesis
mali01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mali00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EYF70_07335
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EYF70_07335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mali01007]
    EYF70_07335
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mali03016]
    EYF70_07335
Enzymes [BR:mali01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EYF70_07335
Amino acid related enzymes [BR:mali01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EYF70_07335
Transfer RNA biogenesis [BR:mali03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EYF70_07335
 Prokaryotic type
   Other AARSs
    EYF70_07335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind Anticodon_1 tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f YjbE
Motif
Other DBs
NCBI-ProteinID: QBI00693
UniProt: A0A411WV76
Position
complement(1708698..1710866)
Genome map
AA seq 722 aa AA seqDB search
MTRKLFVTTALPYANAAFHIGHMMEYIQADIWVRFQRMQRDVVEGEFRPREVHFVGADDT
HGTPIMIAAEKEGITPQEFVAKIAAGRAQYLDGFHIAFDNWYSTDSPENVELSQGIYRKL
RDNGLIQTKTVDRFFDPVKGMFLADRNIKGECPKCGAKDQYGDNCEVCGAAYQPTDLVNP
YSVFTNATPVLKPSEQYFFKLSDPRCFEFLRDWLNTPGRLQPEMVNKVSEWLGEAGEKLA
DWDISRDAPYFGIPIPDAPGKFFYVWLDAPVGYLASLKNYFSKIGIDYDAFLRDPAAEQI
HFIGKDIVSFHLLFWPAMLKFADHPVIDNLKVNVHGHLTVNNEKMSKSRGTGISPLRYLN
LGMNPEWLRYYIAFKLNSKVEDLDFTGEDFVARVNSDLIGKYVNIASRCAGFIAKKFDGK
LSAQLSDTSLGWIKRALTDAEGHVRADSIALSYESREFGKALREIMEIADVTNQYVDENK
PWVLAKDETKLAELHDVCTTALILFRQLTILLSPVLPGVAAKVQAFLNDASLTWADTGVE
AASSAMLGRTIGAYSHLMTRVDAKMIDELFDAPKPAAVAAPVASAAAPAAASAPAADAGS
ATGIEELAPEIKIDDFMKIDLRIAKIVNCEHVEGSEKLLRLTLDVGEGRHRNIFSGIKSM
YQPADLVGKLTVLVANLAPRKMGKFGVSEGMVLAASAADEKANPGIYILNPWPGAEPGMR
IR
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcaagctgttcgtcaccaccgccctgccctacgcaaacgccgccttccatatc
ggccacatgatggaatatatccaggccgacatctgggtccgtttccagcgaatgcagcgc
gatgtggtggaaggtgaattccggccgcgcgaagtacatttcgtcggcgccgacgatacc
cacggcacgccgatcatgatcgccgccgaaaaggaaggcatcacgccgcaggaattcgtg
gccaagatcgccgccggccgcgcccagtacctggacggtttccatatcgccttcgataac
tggtattccaccgattcgccggaaaacgtcgagctgtcgcaggggatctaccgcaagctg
cgcgacaatggcctgatccagacgaaaaccgtcgaccgcttcttcgacccggtgaagggc
atgttcctggcggaccgcaacatcaagggtgaatgcccgaaatgcggcgcgaaggaccag
tatggcgacaattgcgaagtgtgcggcgccgcctaccagccgaccgacctggtgaatccg
tattccgtgttcaccaatgccacgcccgtattgaagccttccgaacaatatttcttcaag
ctgtcggacccgcgctgctttgaattcctgcgcgactggctcaataccccgggccggctg
cagccggagatggtcaacaaggtatcggaatggctgggcgaagccggcgaaaagctggcc
gactgggatatttcccgcgacgcgccctatttcggcatcccgattcccgacgcgccgggc
aagttcttctatgtgtggctggatgcgccggtcggctacctggcgtcgctgaagaattac
ttcagcaagataggcatcgattacgacgccttcctgcgcgacccggccgccgagcagatc
cacttcatcggcaaggatatcgtctcgttccacctgctgttctggccggcgatgctgaaa
ttcgccgaccacccggtgatcgacaacctgaaagtcaatgtgcacggccacctgaccgtg
aacaatgaaaaaatgtccaagtcgcgcggcaccggcatttcgccgctgcgctacctgaac
ctgggcatgaatccggaatggctgcgttattacatcgccttcaagctcaattccaaggtg
gaagacctggacttcacgggcgaggatttcgttgcccgcgtcaattcggacctgatcggc
aagtatgtcaatatcgccagccgctgcgccggtttcattgccaagaaattcgatggcaag
ctgtcggcgcagttgtccgatacctcgctgggctggatcaagcgcgcactgacggatgcc
gaaggccacgtccgcgccgattcgatcgcgctgagctacgagagccgcgaattcggcaag
gcgctgcgcgagatcatggaaatcgccgacgtgacgaaccagtacgtcgatgaaaacaag
ccctgggtattggccaaggatgaaacgaagctggccgagctgcacgacgtctgcacgacg
gcgctgatcctgttccgccagctgaccatcctgctgtcgccggtgctgccgggcgtggcg
gcgaaagtgcaggcattcctgaacgatgccagcctgacatgggccgatacgggcgtggaa
gcggcatcgtcggccatgctgggccgcaccatcggcgcctacagccacctgatgacccgg
gtggatgccaagatgatcgacgagctgttcgatgcgccgaagccggccgccgtggccgct
ccggttgcctccgccgccgcgccggccgcggcttcggcaccggctgccgatgcgggctcc
gccaccggtatcgaggaattggcaccggaaatcaagatcgacgatttcatgaagatcgac
ttgcggatcgcgaagatcgttaattgcgaacacgtggaaggttccgagaaactgctgcgc
ctcaccttggacgtgggcgaaggccgccaccgcaatattttctccggcatcaagtcgatg
taccagccggccgatctcgtcggcaaattgacggtattggtggccaacctggcgccgcgc
aagatggggaaattcggcgtttccgaaggcatggtattggccgcatccgccgcggatgaa
aaagccaatcccggcatttatatcctcaacccatggccgggcgccgagccgggcatgcgc
atccgataa

DBGET integrated database retrieval system