KEGG   Massilia albidiflava: EYF70_17965Help
Entry
EYF70_17965       CDS       T05903                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
mali  Massilia albidiflava
Pathway
mali00450  Selenocompound metabolism
mali01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mali00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EYF70_17965 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mali03016]
    EYF70_17965 (selD)
Enzymes [BR:mali01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     EYF70_17965 (selD)
Transfer RNA biogenesis [BR:mali03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    EYF70_17965 (selD)
 Prokaryotic Type
    EYF70_17965 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: QBI02515
UniProt: A0A411X0X1
Position
4363105..4364154
Genome map
AA seq 349 aa AA seqDB search
MTTEPIKLTSFSHGGGCGCKIAPGVLSEILKNSSGFPVPKELLVGIETADDAAVYKLNDE
QALIATTDFFMPIVDDPFDFGRIAATNAISDVYAMGGTPIMALALVGMPINKLPVETIGR
IIKGGESICAEAGIPIAGGHTIDSVEPIYGLVVLGLVHPSKIKRNADAKAGDVLVLGKPL
GVGVLSAALKKNVLGEEGYAAMIANTTKLNKPGKALSELPGVHALTDVTGFGLLGHLLEL
ARGAGLTAKLAMSQIPLLPGVEQLAHDGYFTGASDRNWEGYGKDVTLSPNVTPAQHTLLT
DPQTSGGLLVSCDPSAVDAVLAIFRDNGFEAAAVIGEMAAGDPRVQVAA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgaaccgatcaaacttacctcgttctcgcacggcggcggctgcggctgcaag
atcgcgcccggcgtgctgtccgagatcctcaagaattccagcggcttccccgtgccgaag
gaactgctggtgggtatcgaaacggccgacgacgcggctgtgtacaagctcaatgacgaa
caggcgctgatcgccaccaccgacttcttcatgccgatcgtcgacgatccgttcgacttc
ggccgcatcgccgccaccaacgcgatttcagacgtgtatgcaatgggcggcacgccgatc
atggcgctggcgctggtcggcatgccgatcaacaagctgccggtggaaaccatcggccgc
atcatcaagggcggcgaatcgatctgcgccgaagcgggcatccccattgccggcggccac
acgatcgattccgtggagccgatctacggcctggtggtgctgggcctggtgcacccgtcg
aagatcaagcgcaatgccgatgcgaaggctggcgacgtgctggtgctgggcaagccgctg
ggcgtgggcgttctgtcggccgcgctgaagaagaacgtgctgggcgaggaaggctacgcg
gccatgatcgccaacaccacgaagctgaacaagccgggcaaggcgctgtccgaactgccc
ggcgtgcatgcgctgaccgacgtcaccggcttcggcctgctgggccacctgctggaactg
gcgcgcggcgccgggctgaccgcgaagctggcgatgtcgcagattcctctgctgccgggc
gtcgagcagctggcgcacgacggctacttcaccggcgcctccgaccgcaactgggaaggc
tacggcaaggacgtgaccctgtcgccgaacgtcacgccggcgcagcacacgctgctgacc
gacccgcaaacctcgggcgggctgctggtgtcgtgcgatccgtcggccgtcgacgccgtg
ctggccatcttccgcgacaacggcttcgaagccgccgccgtcatcggcgaaatggccgcc
ggcgatccgcgcgtgcaagtcgccgcctga

DBGET integrated database retrieval system