KEGG   Microcella alkaliphila: MalAC0309_0088Help
Entry
MalAC0309_0088    CDS       T05359                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
malk  Microcella alkaliphila
Pathway
malk00260  Glycine, serine and threonine metabolism
malk01100  Metabolic pathways
malk01110  Biosynthesis of secondary metabolites
malk01120  Microbial metabolism in diverse environments
malk01130  Biosynthesis of antibiotics
malk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:malk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MalAC0309_0088
Enzymes [BR:malk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     MalAC0309_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BAU30967
UniProt: A0A0U4WSQ8
Position
95752..96876
Genome map
AA seq 374 aa AA seqDB search
MAATDGAPRASGCENERVSRLHDTARRGFASDNYAGVHPEVLAALADANEGHQIAYGEDD
YTARLLEVVRAEFGEQAEVYPVFNGTGANVLALTALMPRWGAVIASGVAHIHTDEGGAPE
RVSGLKLFTVPTDDGKLTPELIDTEAWGWGDEHRAQPLAVSITNSTEVGTVYTPDEVRAI
ADHAHANGMALHLDGARVWNAAASLGTSLSAFTSEAGVDVLSLGGTKNGLLGAEAIVVID
PERAPGLTYLRKMNMQLASKMRFISAQLLTLFDDELGLRSARHANAMAARLRQGLERMVA
SGEVPAGSLGFSQDTQANAVFALLDNAVADRIREKFRFYDWDRARGEVRWMCAFDTSADD
IDAFLRVVHHELTR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtggccgccacggacggcgcgccccgcgcatccgggtgcgagaatgagcgcgtgagccga
ctgcatgacaccgcccgccgaggattcgccagcgacaactacgcgggggtgcaccccgag
gtgctcgccgcgctcgccgacgcgaacgagggccaccagatcgcctacggcgaagacgac
tacacggctcggctgctcgaggtggtgcgcgccgagttcggcgagcaggccgaggtgtac
ccggtgttcaacggcaccggggcgaacgtgctcgcgctcaccgcgctgatgccgcgctgg
ggtgcggtcatcgcgagcggggtcgcgcacatccacaccgacgagggcggggcgcccgag
cgggtcagcggcctgaagctgttcaccgtgccgaccgacgacggcaagctcacccccgaa
ctgatcgacacagaagcctggggctggggagacgagcaccgggcgcagccgctcgccgtg
agcatcacgaactcaaccgaggtgggcaccgtctacacacccgacgaggtgcgcgccatc
gccgaccacgcccacgcgaacggcatggctctgcacctcgacggcgcccgcgtgtggaac
gccgccgcgtcgctcggaacgtcactgtcggcgttcacgtcggaggcgggggtcgacgtg
ctctcgctcggcggcacgaagaacggcctgctcggagcggaagcgatcgtcgtgatcgac
cccgagcgcgcgcccggcctcacctacctgcgcaagatgaacatgcagctggcgagcaag
atgcgtttcatctcggcgcagctgctgacgctcttcgacgacgagctcgggctgcgctcg
gctcggcacgcgaacgccatggccgcgcgcctgcgccaggggctcgagcggatggtcgcg
agcggcgaggtgccagccggctcgctcggcttcagtcaggacacgcaggcgaacgccgtg
ttcgcgctgctcgacaacgcggtcgccgaccgcattcgggagaaattccgcttctacgac
tgggatcgcgcccgcggcgaggtgcgctggatgtgcgccttcgacacgagcgccgacgac
atcgacgccttcctgcgcgtcgtgcaccacgagctgacgcgctag

DBGET integrated database retrieval system