KEGG   Microcella alkaliphila: MalAC0309_0183Help
Entry
MalAC0309_0183    CDS       T05359                                 

Definition
(GenBank) glycerol dehydrogenase-like oxidoreductase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
malk  Microcella alkaliphila
Pathway
malk00561  Glycerolipid metabolism
malk00640  Propanoate metabolism
malk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:malk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MalAC0309_0183
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    MalAC0309_0183
Enzymes [BR:malk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     MalAC0309_0183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: BAU31061
UniProt: A0A0U5BHQ0
Position
complement(192637..193785)
Genome map
AA seq 382 aa AA seqDB search
MSDSLAVKTIISPGRYVQGRGAIRRLGEFLKPLGETPLLVADDVVWGFVGHDVESSLTAA
GLPVIRERFGGIPSAAEVDRLVAVIREHNADVIVAVGGGSTIDAVKASGYLAGIRWVTVP
TVASTDAPTSALSVIYTENGEFEEYRFFPKNPDLVLVDTQVVANAPAAFLAAGVGDALAT
WLEARATANAHANTMAGGLPTLTGTALAQLSWEVLWDNALPALDAVRDNLVTPAVEKVVE
ANTLLSGIGFESGGLAAAHAIHNGLTAVPQTHGLAHGEKVNIGSVTQLVLEGAPTDEIRA
FIEFTTRVGLPNTLTEVGLSPEDDAELQIIAVAATAPGETIHSMPFEISPAELVSALKSI
ERFARTVRSEAGLASPVPRAHH
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattccctcgcagtcaagacgatcatcagccccggtcgttacgtccaagggcgg
ggcgctatccgcaggctaggagagttcctcaagccactcggggagacaccgctgctcgtc
gctgacgacgtcgtctggggcttcgtcggccacgacgtcgagtcctcgctcacggcggcc
ggtctcccggttatccgtgagcgattcggcggcatcccctcggccgcagaagtggaccgt
ctggtcgcggtcatccgcgagcacaacgccgatgtcatcgtcgccgtcggcggcggcagc
acgatcgacgctgtgaaggcatccgggtacctcgccggaatccgctgggtcacagtgccc
accgtcgcctccaccgacgcaccgacctcggccctgtccgtgatctacaccgagaacggc
gagttcgaggagtacaggttcttccccaagaaccccgatctcgttctcgtcgacacccaa
gtggtggcgaacgctcccgccgcgttcctagccgccggcgtgggagatgccctggcgacc
tggctggaagcgcgcgcgaccgcgaacgcccacgcgaacacgatggccggcggcctgccg
acactcaccggcacggcgctcgcacagctgtcctgggaggtcctctgggacaacgcgctg
cccgccctggacgcagtccgcgacaatctggtcactccggccgtggagaaggtcgtggag
gcgaacaccctgctctcgggcatcggattcgaatccggtgggctcgccgccgcgcatgcg
atccacaacggtctgaccgccgtgccccaaacgcatggtcttgcgcacggggagaaggtc
aacatcggctctgtcacccagctggtgctcgagggcgcgccgactgacgagatccgcgcg
ttcatcgagttcaccactcgcgtcggcctcccgaacacgctcaccgaggtcgggctgtca
ccggaggacgacgccgaactgcagatcatcgcggtcgccgcgacggctcccggagagacc
atccacagtatgccgttcgagatcagccccgcggagctcgtctcggcgctgaagtccatc
gagcgcttcgctcggaccgtgcgttccgaagccggtctcgcctctcctgttccgcgagcc
caccactga

DBGET integrated database retrieval system