KEGG   Microcella alkaliphila: MalAC0309_1855Help
Entry
MalAC0309_1855    CDS       T05359                                 

Definition
(GenBank) HAD-superfamily hydrolase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
malk  Microcella alkaliphila
Pathway
malk00010  Glycolysis / Gluconeogenesis
malk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:malk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MalAC0309_1855
Enzymes [BR:malk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     MalAC0309_1855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like ChuX_HutX Paramyxo_C HemS
Motif
Other DBs
NCBI-ProteinID: BAU32703
UniProt: A0A0U5BER9
Position
1844546..1845160
Genome map
AA seq 204 aa AA seqDB search
MLFLFDMDDVLCDYDWRTRMAALTARTGHDLTELRRRWWLNGLEFAAEAGDPADADEYLA
VVTAAIGADIPRKEWVRIRAESTVARPEAVDAVRRAAEFGRVALLTNNSILIHEHLHEVA
SELAEVMGREHLHASARFGARKPDPAVYARAMEHYGATAAQTFFTDDRPDNVAGAESLGI
TGHVYVHAAGLRAAIGAFAERAAA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgctgtttctgttcgacatggacgacgtgctgtgcgactacgactggcgcacgcggatg
gcggccctgacggcccgaacggggcacgatctcaccgagttgcggcggcgctggtggctg
aacggcctcgaattcgcggccgaggccggcgatccggccgacgccgacgagtacctggcc
gtcgtgacggcagcgatcggggcggacattcctcgaaaggaatgggtgcgcatccgggcg
gaatcaacggtcgcgcggccagaggcggtggatgccgtgcggcgggccgccgaattcggt
cgcgtcgcgttgctgacgaacaattcgatcctgatccacgagcatctgcacgaggtcgcg
tccgagctcgccgaggtgatgggacgcgagcatctgcacgcgagcgcccggttcggggcc
cggaagcccgaccccgccgtctacgcccgcgccatggagcactacggggcgaccgcggca
cagacgttcttcaccgacgaccggcccgacaacgtcgccggcgccgaatccctcggcatc
accggtcacgtgtacgtacacgcggccggcctgcgggccgcgatcggcgcgttcgctgaa
cgcgccgccgcctga

DBGET integrated database retrieval system