KEGG   Mameliella alba: KU6B_09750
Entry
KU6B_09750        CDS       T06509                                 

Definition
(GenBank) dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
malu  Mameliella alba
Pathway
malu00230  Purine metabolism
malu01100  Metabolic pathways
malu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:malu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KU6B_09750
Enzymes [BR:malu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     KU6B_09750
SSDB
Motif
Pfam: Ald_Xan_dh_C2
Other DBs
NCBI-ProteinID: BBU54710
UniProt: A0A6F8Q2B6
Position
970430..972295
AA seq 621 aa
MKPGAPQIHEVGPGGNLVLDPVRVERGDVDKGFAEADFVLEGEFSGGRPMPGYMEPNVCL
ADWDGSGKLTFWTSTQSSFMVRGILAEVLGLPRTKVRVLVDHMGGGFGAKQDCFQHEFLC
ALLARETRKPVRMEFTRRETFLAGRSRHPFKLWLKQGFRKDGTITARDMRIVFDSGAYGS
HSPGVTTVGTNSATSLYRCENVRLDGRAVYTNTPIAGAFRGYGVVQTYYALDIQMDEAAE
RLGMDPADLKLKNAVREGDIAPSGHAIVGHGLEACIEHGTRVFDWKGLRQGARCPDPAAS
HVRKGWGLGCEMHGSSAYPGIKEQGNALIKVNEDGSVTLMTGAAGLGTGAHTALAQIAAE
ELNMPFESVSVVHGDTDAVPWDIGAFASHTTYLVGSATRMAAAEARAGILRRAAEKLQTT
ADALDMVEGRIFLRASPDSGLTVAEAMGPTPGIPSANILGRGTYEPTKSYSFAAHFVEVT
VDTETGLVTVDRVVPVHDVGKVIHPIAAAGQIEGGIQQGIGHTLTEDYIIDTETGRSLNA
GLVDYKMPLSMDMPDIDTVILEAAPDPGGPWGAKGVGEDPIIAIGPAIANAIHDAIGVRF
HHYPITPEDILNALNEKERQS
NT seq 1866 nt   +upstreamnt  +downstreamnt
atgaaaccgggcgcgccgcagatccatgaggtggggccgggcggcaaccttgtgctggac
ccggtgcgcgtggaacgcggcgatgtcgacaaggggttcgccgaggcggattttgtgctt
gagggcgaattctccggtggtcggcccatgcccggctacatggagcccaatgtctgcctg
gccgattgggacgggtccggcaagctgactttctggacctcgacccaaagctctttcatg
gtccgaggcatcttggccgaggtgctggggctgcccagaaccaaagtgagggtgctggtc
gatcacatggggggcggctttggcgccaagcaggattgcttccagcatgagttcctctgc
gcattgctggcgcgggagacgcgcaagccggtgcggatggaattcacgcggcgtgagacc
ttccttgccggacggtcgcgccacccgttcaagctgtggctgaaacaggggttccgcaag
gacggcacgatcaccgcgcgcgacatgcggatcgtgttcgactccggggcctatgggtct
cacagcccgggggtcacgacggtgggcaccaattcggccacctcgctctaccgctgcgaa
aacgtgcggttggatgggcgcgcggtctataccaacaccccgattgcgggcgcatttcgc
ggttatggcgtggtgcagacctactacgccctcgacatccagatggacgaggcggcagag
cggctggggatggacccggcggacctgaaactgaaaaacgctgtgcgtgagggcgatata
gcgccttctggccacgcgatcgtcgggcatgggttggaggcctgcatcgagcatggcacg
cgggtctttgactggaaggggttgcggcagggggcgcgctgccccgacccggcggcgtcg
catgtccgcaagggctggggtctgggctgtgaaatgcacggctcctctgcctatcccggc
atcaaggaacagggcaatgccctcatcaaggtgaacgaagacggctcggtgacgttgatg
accggcgcggcgggcctgggcacgggcgcccataccgcgcttgcgcagatcgcggcggaa
gagctgaacatgccctttgaaagcgtctcggtcgtgcatggcgataccgacgccgtgccc
tgggacatcggtgcctttgccagccacaccacttacctggtgggcagcgccactcggatg
gccgccgccgaggcgcgcgccggtatcctgagacgtgccgctgaaaagcttcagaccacg
gccgatgcgctggacatggtcgaaggacggatcttcctgcgtgcaagtcctgacagcggc
ctcaccgtggccgaggctatggggccgaccccagggatcccgtccgccaatatcctgggg
cgggggacctatgaaccgaccaagtcctattcctttgcagcgcatttcgtcgaggtgacg
gtggacacggaaaccggcctggtgacggtggacagggtggtcccggtgcatgacgtcggc
aaggtgatccacccgatcgctgctgccggccagatcgagggcggcatacagcagggcatc
ggtcacaccctgaccgaggattacatcatcgacacggaaaccggccggtctctgaatgcg
gggctggtggattacaagatgccgctgtcgatggacatgcccgatatcgacaccgtgatc
ctggaggcggcccccgatcccggcggcccctggggcgccaagggggtcggcgaagacccg
atcatcgccatcggaccggccatcgccaacgcgattcacgacgcgatcggggtgcggttc
catcactacccgatcacccccgaagacattctgaatgccctcaacgagaaggagcgccaa
tcatga

DBGET integrated database retrieval system