KEGG   Mycolicibacterium alvei: MALV_52140
Entry
MALV_52140        CDS       T06961                                 

Definition
(GenBank) oxidoreductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
malv  Mycolicibacterium alvei
Pathway
malv00903  Limonene and pinene degradation
malv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:malv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MALV_52140
Enzymes [BR:malv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     MALV_52140
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Pterin_bind
Other DBs
NCBI-ProteinID: BBX30089
UniProt: A0A6N4V046
Position
complement(5397088..5397921)
AA seq 277 aa
MEGKVAFVTGAARGQGRSHAVRLAQEGADIIAIDICGPIRPGVETAIPASTSDDLAETAN
LIKGLNRRVVTAEVDVRDADAIKAAVDSGVEQLGRLDVIVANAGIGNGGDVLHETSQLDW
DEMIDINLSGVWKSVKAGVPHLIEGGRGGSIILTSSVGGLKAYPHCGNYVAAKHGVVGLM
RGFAVELGQHNIRCNTVHPTHVATPMLHNDGTFKMFRPDLENPGPDDMAPICQLFHTLPI
PWVEAVDISNAVLFLASDEARYITGVTLPVDAGSCLK
NT seq 834 nt   +upstreamnt  +downstreamnt
atggaaggcaaggtcgcgttcgtcaccggcgcggcccgtggccagggacgtagccacgcg
gtacggctggcgcaggagggcgccgacatcatcgcaatcgacatctgtggaccgatccgg
cccggcgtggagaccgccatcccggcgtcgacctccgatgatctggccgagaccgcgaat
ctcatcaaggggctcaaccgtcgcgtcgtcaccgccgaggtagatgtccgcgatgccgat
gcgatcaaggcggccgtggacagcggtgtcgaacagctcggccgcctcgacgtcatcgtg
gcgaacgccggtatcggcaacggcggcgacgtcctgcacgagaccagccagctggactgg
gacgagatgatcgacatcaacctttcgggcgtctggaagtcggtcaaagccggtgtgccg
cacctgatcgagggtggccgcggcgggtcgatcatcctgaccagctcggtcggcggcctc
aaggcctacccgcactgcggcaactacgtcgccgccaagcacggcgtcgtcggcctgatg
cgcggcttcgccgtggagctcggccagcacaacatccgttgcaacaccgtgcatcccacc
cacgtggcgaccccgatgctgcacaacgacggcaccttcaagatgttccggcccgacctg
gagaacccgggccccgacgacatggcgccgatctgccagcttttccacaccctgcccatc
ccgtgggtcgaggccgtggacatcagcaacgccgtgctgttcctggcctccgacgaggcc
cgctacatcaccggtgtgacactgccggtcgacgcgggaagctgcctcaagtag

DBGET integrated database retrieval system