KEGG   Mesorhizobium australicum: Mesau_01059Help
Entry
Mesau_01059       CDS       T02417                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mam  Mesorhizobium australicum
Pathway
mam00020  Citrate cycle (TCA cycle)
mam00640  Propanoate metabolism
mam00660  C5-Branched dibasic acid metabolism
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01120  Microbial metabolism in diverse environments
mam01130  Biosynthesis of antibiotics
mam01200  Carbon metabolism
Module
mam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesau_01059
   00640 Propanoate metabolism
    Mesau_01059
   00660 C5-Branched dibasic acid metabolism
    Mesau_01059
Enzymes [BR:mam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mesau_01059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 FimP
Motif
Other DBs
NCBI-ProteinID: AGB43538
UniProt: L0KHI8
Position
1108832..1110025
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQGKALLKSFGAPVAEGVPVFKASEAEAAAQALPGPLYVVKSQIHAGGRGKGKFK
ELGADAKGGVRLAKSVAEVVANANEMLGHTLVTKQTGPAGKQVNRLYIEDGADIERELYL
SILVDRSVGRIAFVVSTEGGMDIEGVAHDTPEKIITVAIDPEKGVTAEDVKALNDALKLD
GDAARDGGTLFPILYKAFVEKDMSLLEVNPLIVMKDGHLRVLDAKVSFDNNALFRHPDVL
ELRDTSEEDEKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITRDPAVKGILINIFGGIMKCDIIAEGVIAAVKEVGLKVPLVVRLE
GTNAELGKKIINDSGLNVVSADDLDDAAKKIVAAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccatgaatatcaaggcaaggcgctgctgaagagctttggcgcgccggtggcc
gaaggcgtgccggttttcaaggcaagcgaggcggaagccgctgcacaggcgctgcccggc
ccactctatgtggtgaagagccagatccatgccggcggccgcggcaaaggcaaattcaag
gaactcggcgccgacgccaagggcggtgtgcggctggcgaagtccgtcgccgaggtggtc
gccaacgccaacgagatgctcggccatacgctggtgaccaagcagaccggcccggccggc
aagcaggtcaaccgcctctatatcgaggacggcgccgacatcgagcgcgagctctatctc
tccatcctggtcgaccgctcggtcggccgcatcgcctttgtcgtctcgaccgagggcggc
atggacatcgagggcgtcgcgcacgacacgccggaaaagatcatcaccgtcgccatcgat
ccggaaaagggcgttacggctgaggacgtcaaggcgctcaacgatgcgctgaagctcgac
ggcgacgcggccagggacggcggcacgctgttcccgatcctctacaaggccttcgtcgag
aaggacatgagtctgctcgaggtcaacccgctgatcgtcatgaaggatgggcatctgcgc
gtgctcgacgcgaaggtgtcgttcgacaacaacgcgctgtttcgccacccagatgtgctc
gaactgcgcgacacgtcagaagaggacgagaaggagatcgaggcgtcgaaatacgacctc
gcctatgtcgcgctcgatggcaatatcggctgcatggtcaacggcgccggccttgccatg
gcgacgatggacatcatcaagctctacggcgccgaacccgccaacttcctcgatgtcggc
ggcggcgcttccaaggagaaggtgacggccgcgttcaagatcatcaccagggatccggcg
gtcaagggcatcctgatcaatatcttcggcggcatcatgaagtgcgacatcatcgccgag
ggtgtgattgccgcggtcaaggaagtcgggctcaaggtgccgctggtcgtgcgcctggaa
ggcaccaatgccgagcttggcaagaagatcatcaacgacagcggcctgaacgtcgtctcg
gccgacgatctcgacgacgcggccaagaagatcgtggcggcggtgaagggctga

DBGET integrated database retrieval system