KEGG   Mesorhizobium australicum: Mesau_01087Help
Entry
Mesau_01087       CDS       T02417                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mam  Mesorhizobium australicum
Pathway
mam00020  Citrate cycle (TCA cycle)
mam00190  Oxidative phosphorylation
mam00650  Butanoate metabolism
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01120  Microbial metabolism in diverse environments
mam01130  Biosynthesis of antibiotics
mam01200  Carbon metabolism
Module
mam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mam_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesau_01087
   00650 Butanoate metabolism
    Mesau_01087
  Energy metabolism
   00190 Oxidative phosphorylation
    Mesau_01087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_D Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: AGB43566
UniProt: L0KEX4
Position
1135064..1135459
Genome map
AA seq 131 aa AA seqDB search
MSAKNTDMRTPLARVRGLGSAREGTGHFWRQRLTAIANIPLILFFTGFLIALNGAGYAQV
RAALANPFVALVMALVLISPLYHMRIGMQVIIEDYVHGEGMKLTLIALNTFFTIAVGVAS
LFALLKLAFGG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgaagaacaccgacatgcgcaccccgctggccagggtgcgcggcctgggctct
gcccgcgaaggcaccgggcatttctggcgccagcgattgacggcgatcgccaacatcccg
ctgatcctgtttttcaccgggttcctgatcgcgctcaacggcgccggctatgcacaggtg
cgggctgcgctcgccaacccgttcgtggcgctggtgatggccctggtgctcatctcgccg
ctctatcatatgcggatcggcatgcaggtgatcatcgaggactatgtgcatggcgaaggc
atgaagctgacgctgatcgccctcaacacattcttcaccatagcagtcggcgtcgcttcg
ctgttcgccctgctgaaactggcattcggaggctga

DBGET integrated database retrieval system