KEGG   Mesorhizobium australicum: Mesau_01127Help
Entry
Mesau_01127       CDS       T02417                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mam  Mesorhizobium australicum
Pathway
mam00010  Glycolysis / Gluconeogenesis
mam00520  Amino sugar and nucleotide sugar metabolism
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01120  Microbial metabolism in diverse environments
mam01130  Biosynthesis of antibiotics
mam01200  Carbon metabolism
Module
mam_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesau_01127
   00520 Amino sugar and nucleotide sugar metabolism
    Mesau_01127
Enzymes [BR:mam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Mesau_01127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AGB43606
UniProt: L0KF18
Position
complement(1171137..1171841)
Genome map
AA seq 234 aa AA seqDB search
MAKVVKKAASDTGQVVLSIDIGGSHVKILTSDGGTERRTDSGPDLTPRQMIDKVKKLADG
LSYDVISMGYPGPVRQNKPVLDPMNLGKGWAGFDFTAEFGKPVKVVNDALMQALGSYEGG
RMLFLGLGTGLGAAMVLDNVGQPMELAHLPYRKGQSFEDYVGERGLVKRGKKKWRGHVFD
VVNRLRAALQPDYVVIGGGNVDKLDELPPDSRRGDNTRAFEGGFRLWRDKALIV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggtggttaagaaggctgcgtcggacaccgggcaggtagtcctttcgatcgat
attggcgggtcgcacgtcaagatcctgaccagcgacggtggcaccgagcgccgcaccgat
tccgggcctgacctgacgccaaggcagatgatcgacaaggtgaagaagctcgccgacggc
ctgtcctatgacgtcatttcgatgggctatccgggccccgtgcgtcaaaacaagccggtg
ctcgatcccatgaatctcggcaagggctgggccggcttcgatttcaccgctgagttcggc
aagccggtcaaggtggtcaatgacgcgctgatgcaggccctcggcagctatgagggcggg
cgcatgctgttcctcggcctcggaaccggcctcggtgccgcgatggtcctcgacaatgtc
ggccagccgatggaactcgcccaccttccctacagaaaaggccagagtttcgaggactat
gtcggtgaacgtggcctcgtaaagcgcggcaagaagaagtggcgcggtcatgtcttcgac
gtcgtcaaccggctgcgcgccgccctgcagccagactatgtcgtcatcggcggcggcaat
gtcgacaagctggacgaattgccccccgactccaggcgcggtgacaacacacgcgccttt
gaaggcggatttcgtctgtggcgcgacaaggccctgatcgtctga

DBGET integrated database retrieval system