KEGG   Mesorhizobium australicum: Mesau_01406Help
Entry
Mesau_01406       CDS       T02417                                 

Definition
(GenBank) geranylgeranyl pyrophosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
mam  Mesorhizobium australicum
Pathway
mam00900  Terpenoid backbone biosynthesis
mam01100  Metabolic pathways
mam01110  Biosynthesis of secondary metabolites
mam01130  Biosynthesis of antibiotics
Module
mam_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:mam00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mesau_01406
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mam01006]
    Mesau_01406
Enzymes [BR:mam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Mesau_01406
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Mesau_01406
Prenyltransferases [BR:mam01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Mesau_01406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AGB43875
UniProt: L0KH90
Position
complement(1455407..1456324)
Genome map
AA seq 305 aa AA seqDB search
MTNDDEMAFEMALIRRAAAVEVMLRRLLDDRPLSGEIARPDRLMAAMRHGVLNGGKRLRP
FLVMESAALFSADGEAALRVAAALECVHCYSLIHDDLPAMDDDDLRRGQPTVHKAFDEAT
AILAGDALLTLAFDIIAGEATALPAERRAALVLALARAAGAGGMVGGQKLDLEAEQVRPD
EAGIIKLQAMKTGALIRFACEAGAILAGAQSDDLERLAEFGSAIGLAFQLADDLLDLTAD
AEQMGKATGKDAAAGKGTLVALHGADWARKQLDGLVGQAHALLEPYGEKAALLKAAAIFV
ATRNS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgacgacgaaatggcgttcgaaatggcgctcatcaggcgcgcggccgccgtc
gaggtgatgctgcgtcgcttgctcgacgatcgcccgctttcgggtgagatcgctcggccc
gatcgtctgatggcggcgatgcgccatggcgtgttgaacggcggcaagcgcctgcgcccc
ttcctggtcatggaaagtgccgccctgttttccgccgatggcgaagcggcgttgcgcgtc
gcggcggcgctcgaatgcgtgcattgctattcgctgatccacgatgacctgccggcgatg
gacgacgatgaccttcgccgcggccagccgaccgtgcacaaggcctttgacgaagccacc
gccatcctcgcgggcgacgccttgctgacgcttgccttcgacatcatcgccggcgaagcg
acggcgctcccggccgaacggcgcgcagccctggtgctggcgctcgcccgcgccgccggg
gccggtgggatggtcggcggccagaagctagacctcgaagccgagcaagtgcgaccggac
gaggccggcatcataaagctgcaggcgatgaagaccggcgcgctgatccgcttcgcctgc
gaggcgggtgcgatcctggccggcgcacagtcggatgacctggaaaggcttgccgagttc
ggttcggcgatcggcctggccttccagctcgccgacgacctgctggatctgacggccgac
gccgagcagatgggcaaggcgaccggcaaggatgccgccgcgggcaagggtacgctggtg
gccttgcacggtgcggattgggcacgcaagcagctcgacggcctcgtcggccaggcgcac
gcgctgctcgaaccctatggcgaaaaggctgccctgctgaaagccgcggcgatcttcgtc
gcaacccgtaacagctga

DBGET integrated database retrieval system